KEGG   Nibricoccus aquaticus HZ-65: CMV30_02065Help
Entry
CMV30_02065       CDS       T05426                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CMV30_02065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbh02000]
    CMV30_02065
Enzymes [BR:vbh01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     CMV30_02065
Transporters [BR:vbh02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    CMV30_02065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N SbcCD_C AAA_29 RsgA_GTPase AAA_30 AAA_23 Zeta_toxin MMR_HSR1 AAA_10
Motif
Other DBs
NCBI-ProteinID: ATC62844
UniProt: A0A290Q2W3
Position
complement(484611..486128)
Genome map
AA seq 505 aa AA seqDB search
MSSTPLLQMRGIGKRFPGVVALAGVDLSVRSGEIHALLGENGAGKSTLIKVLTGVYSLDD
GQILLDGKSVRPATPKDAEDCGISTVYQEVNLIPALSVAENIGLGRQPGKLGFLNWGALR
RHAREVLARLDLQSIDVDAELGSLSVAMQQMVAIARALDLKAKLLILDEPTASLDEKEVA
DLFAVMRRLKGEGLGIIFVTHFLDQVYAVTDRITVLRNGALVGEYLTAELPRLKLVSRMI
GREVHDNAPRSADLKAVADNAECVVETKGIARRGAINPIDLTIRKGEVTGLAGLLGSGRS
ETARLIFGIDSADGGEIHVKGKKVPMSSPREAIAHGFAFCSEDRKVEGILPNLSVRENLI
FALQAKRGAWKTLSHEEQMTLCNHYITALRIKTASTETAIRNLSGGNQQKVLLARWLATQ
PELIILDEPTRGIDIGARAEIEQLIHKLRADGIAVLLISSEIEEIVRNSTRVVVLRERRK
TCELVGDEIDPSRLMRAMAGGHETS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagttccaccccgctgcttcaaatgcgcggcatcgggaaacgatttcccggtgtcgtc
gctctcgcgggcgtggatctcagcgttcgctccggtgaaattcacgcgctcctcggcgaa
aacggcgcgggcaaatcgacactcatcaaagtcctcacgggcgtttactcgctcgatgac
ggccagatcctgctggatggaaaatccgtccgtccggccacgccaaaagatgccgaggac
tgcggcatcagcacggtttaccaggaggtgaatctgattcctgcgctctccgtcgccgag
aatatcggcctcggtcgtcagccgggaaaactgggtttcctcaactggggcgcactccgc
cgccacgcgcgcgaagtgctcgcacgcctcgatctccagtccatcgacgttgatgccgaa
ctcggctcgttgtcggtcgcgatgcagcagatggtcgccatcgcgcgtgctctcgatctc
aaggcgaagctcctgattctcgacgagccgaccgccagcctcgatgaaaaggaagtcgct
gatcttttcgccgtcatgcgccgtctgaaaggcgaggggctcggcatcattttcgtcacg
cattttctcgatcaggtttacgcggtcaccgatcgcatcacggtgcttcgcaacggcgct
ctggtaggcgagtacctcaccgccgagctgccccgcctgaaacttgtgagccgcatgatc
ggccgtgaagtccacgacaacgccccgcgctctgccgatctgaaagccgtcgccgacaac
gccgaatgcgtcgtcgagaccaagggcatcgcccgtcgcggtgcgatcaacccgatcgat
ctcaccatccgcaaaggcgaggtcaccgggctcgccggtctgctcggctccggccgctcc
gagacggcgcgactcatcttcggcatcgattcggcggatggcggcgagattcacgtgaaa
gggaaaaaagtcccgatgtcgtctccgcgtgaagcgatcgcgcacggtttcgcgttttgc
tccgaggaccggaaggtcgagggcattctcccgaatctttccgtccgcgagaatctgatc
ttcgccctccaggccaaacgcggcgcgtggaaaacgctttcgcacgaggagcagatgacg
ctctgcaatcactatatcaccgcgctgcgtatcaagaccgccagcacggagaccgcgatc
cgcaatctctccggcggcaaccagcaaaaagttctcctcgcccgctggctcgcgacgcag
ccggagctgatcattctcgatgaaccgacgcgcggcatcgacatcggcgcccgcgccgag
atcgagcagttgatccacaagctccgcgccgacggcatcgcggtgctgctcatttcctcg
gagatcgaagagatcgtccgcaacagcacgcgcgtcgtcgtgctccgcgagcgccgcaag
acctgcgaactcgtcggtgacgagatcgatccgtcgcgcctgatgcgcgccatggccgga
ggacacgaaacgtcatga

DBGET integrated database retrieval system