KEGG   Nibricoccus aquaticus HZ-65: CMV30_02070Help
Entry
CMV30_02070       CDS       T05426                                 

Definition
(GenBank) LacI family transcriptional regulator
  KO
K23508  galactofuranose transport system substrate-binding protein
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CMV30_02070
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbh02000]
    CMV30_02070
Transporters [BR:vbh02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    CMV30_02070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ATC62845
UniProt: A0A290Q2G5
Position
complement(486209..487165)
Genome map
AA seq 318 aa AA seqDB search
MKTSLFRRSIACLGFAFVSLTAVVAAAEKKLTVGFAQTGAESAWRTANTNSMKTEADKRG
INLKFADGQGQLENQIRAVRSFVTQRVDVIVIAPIKTTGWDNVLREAKRAKIPVVIMDRQ
IETTDETLFHCFVGSNFYEEGQMAVEWLAKNRDERTKIVELQGTPGSAAANDRRKAFADG
LAKHSDLKIIDSQSGDFSRAKGKEVMEAFLKKHGKAIEIVYAHNDDMALGAIQAIEEAGL
KPGKDIIIVSVDAIKEAVQAVADGKISVTVECNPLFGPKIYDTIDKILKGEKVERVSYNK
DELFDSTNAAARVSTREY
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctccctgttccgccgctcgatcgcctgcctcggtttcgccttcgtttcgctg
accgccgtggtggccgccgccgagaaaaaactcaccgtcggcttcgcgcagacgggtgcc
gaaagcgcctggcgcacggccaacaccaactcaatgaagaccgaggccgacaagcgcggc
atcaacctcaagttcgccgacggccagggccagctcgagaatcagatccgcgcggtgcgc
tcgtttgtcacgcagcgtgtcgacgtcatcgtgatcgcgcctatcaagacgaccggctgg
gacaatgttctccgcgaagccaagcgcgccaagatcccggtcgtgatcatggaccgccag
atcgagaccactgatgaaacgctgttccactgcttcgtcggttccaatttctacgaagaa
ggccagatggccgttgagtggctcgccaagaaccgcgacgagcgcaccaagatcgtcgag
ctccagggaacgcccggttccgccgccgccaacgaccgccgcaaagctttcgccgacgga
ctcgcgaaacactccgatcttaagatcatcgattcccagagcggcgacttcagccgcgcc
aagggcaaggaagtcatggaggccttcctcaagaaacacggcaaagccatcgagatcgtc
tacgcgcacaacgacgatatggcgctcggcgcgatccaggccatcgaggaagccggcctg
aaacccggcaaggacatcatcatcgtttccgtcgacgctattaaagaagccgtgcaggcc
gtggccgacggcaagatcagcgtcaccgtcgagtgcaatcctctcttcggaccgaaaatc
tacgacaccatcgacaagattttgaagggcgagaaggtcgaacgcgtttcctacaacaag
gacgagctcttcgactccaccaacgccgccgcccgcgtcagcacccgcgaatactga

DBGET integrated database retrieval system