KEGG   Nibricoccus aquaticus HZ-65: CMV30_02305Help
Entry
CMV30_02305       CDS       T05426                                 

Definition
(GenBank) ABC transporter
  KO
K15581  oligopeptide transport system permease protein
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh01501  beta-Lactam resistance
vbh02010  ABC transporters
vbh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CMV30_02305
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CMV30_02305
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CMV30_02305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbh02000]
    CMV30_02305
Transporters [BR:vbh02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    CMV30_02305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF2976
Motif
Other DBs
NCBI-ProteinID: ATC62887
UniProt: A0A290Q3M1
Position
541114..542133
Genome map
AA seq 339 aa AA seqDB search
MLRFFLSRFLQSCVALFIIITATFFMQRFVPGGPFTQERATTPEIEQRIKEYYRLNDPLW
KQYADYMWDITPKKFAPLELRHGLDFKAAFGIDLRPSYRYASYTVNEIIADKLPVSIELG
FLALIVALLIGVPLGVIAAMRRNTWPDYGASSFGMIGISTPTFVVGPIAVLLFAIYWRQV
PASGWVRWDEIASGRQTLADLISTRILPALVLGIAFAAPILRITRGGMLDVLNQDFIRTA
RAKGASELRIVLRHGLRGGLLPLVSYLGPAIAGVLTGSFVIETIFQIPGLGREFVTSIGN
RDYMLVIGTVIIYAGFIMALNLLADVVQAWMNPKIRLDS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgctccgctttttcctctcacgcttcctacagtcctgcgtcgcgctgttcatcatcata
acagccacgttcttcatgcagcgctttgtgccgggcggccccttcactcaggaacgcgcc
accacccccgagatcgagcagcgcatcaaggaatactaccggctcaacgatccgctctgg
aaacagtacgcggattacatgtgggacattactccgaagaaattcgccccgctcgaactc
cgccacggcctcgatttcaaagccgccttcggcatcgatctccgcccctcgtaccggtac
gccagctacacggtcaacgagatcatcgccgataaactccccgtctcgatcgagctcggg
ttcctcgccctcatcgtcgctctcctcatcggcgtccctctcggcgtgatcgccgccatg
cgccgcaacacctggcccgactacggcgcatccagcttcggcatgatcggcatctccacg
cctaccttcgtcgtcggccccatcgccgtccttctcttcgcgatctactggcgccaagtc
cccgcctcgggctgggtccgctgggacgaaatcgccagcggccgccagaccctcgccgac
ctcatctccacccgcatcctccccgccctcgtcctcggcatcgccttcgccgcgcccatc
ctccgcatcacccgcggtggtatgctcgacgttctcaaccaggacttcatccgcaccgcc
cgcgccaaaggtgcctccgagcttcgcatcgtcctgcgccacggcctgcgcggcggcctg
ctcccgctcgtctcctacctcggccccgccatcgccggcgtcctcaccggttccttcgtg
atcgaaaccattttccaaatacccggcctcggccgcgaattcgtcaccagcatcggtaac
cgcgactacatgttggtgatcggcaccgtcatcatctacgccggcttcatcatggcgctc
aacctcctcgccgacgtcgtccaggcctggatgaatcccaagatccgcctcgactcctga

DBGET integrated database retrieval system