KEGG   Nibricoccus aquaticus HZ-65: CMV30_02310Help
Entry
CMV30_02310       CDS       T05426                                 

Definition
(GenBank) peptide ABC transporter permease
  KO
K15582  oligopeptide transport system permease protein
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh01501  beta-Lactam resistance
vbh02010  ABC transporters
vbh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CMV30_02310
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CMV30_02310
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CMV30_02310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbh02000]
    CMV30_02310
Transporters [BR:vbh02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    CMV30_02310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N Caveolin
Motif
Other DBs
NCBI-ProteinID: ATC62888
UniProt: A0A290QC38
Position
542140..543081
Genome map
AA seq 313 aa AA seqDB search
MPAAPSAPPAAAPAPLAIERGTSLSRDAWHRLRKNKLAVFGMVSLAIITLACVFGPMISP
YSISEMPFENVGEPPSWKHWFGTDDNGGRDLLVRVLVGGRLSLAVGLCATFVALTIGVTY
GAIAGYVGGKVDALMMRIVDIIYALPFTIFVILLMVFTRTLTIKYNLPASFDLLLIFAAI
GAVEWLTMARIVRGQVMSIKKMEYVEAARSLGYGPARIIFRHILPNTLGPIIVYTTLTIP
SVMLLEAFLSYLGLGVQAPMSSWGVLLNDGQQKLEEFPWLLLFPAGMFSWTLFSLNFLGD
GLRDALDVRSSKD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgcaccttccgctccacccgccgccgccccggctccgctcgccatcgagcgc
ggcacctccctctcgcgcgacgcctggcaccgcctccgcaaaaacaaactcgccgtcttc
ggtatggtctcgctcgcgatcatcaccctcgcctgcgtcttcggccccatgatcagcccg
tacagcatttccgaaatgccgttcgaaaacgtcggcgagccccccagttggaaacactgg
ttcggtaccgacgataacggcggccgcgacctcctcgttcgcgttctcgttggcggccgc
ctctccctcgctgtcggcctctgcgccaccttcgtcgccctcaccatcggcgtcacctac
ggcgccatcgccggctacgtcggcggcaaagtcgatgcgctcatgatgcgcatcgtggac
atcatctacgcactgcccttcacgatcttcgtcatcctgctgatggttttcacccgcacg
ctcacgatcaaatataacctccccgcctccttcgatctcctcctcatcttcgccgccatc
ggcgccgtcgaatggctcaccatggcccgcatcgtccgcggccaggtcatgtccattaag
aaaatggaatacgtcgaagccgcccggtccctcggctacggccccgcgcgcatcatcttc
cgtcacattcttcccaataccctcggcccgatcatcgtctacaccacgctcaccattccg
tccgtgatgttgctcgaagccttcctcagctacctcggcctcggcgtccaggccccgatg
agctcatggggcgtgctgctcaacgacggccagcaaaaactcgaagagttcccctggctt
ctcctcttccctgccggcatgttctcctggacccttttctccctcaacttcctcggcgac
ggcctccgcgacgccctcgatgtgcgctcctccaaagactga

DBGET integrated database retrieval system