KEGG   Nibricoccus aquaticus HZ-65: CMV30_02420Help
Entry
CMV30_02420       CDS       T05426                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K11707  manganese/zinc/iron transport system substrate-binding protein
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CMV30_02420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbh02000]
    CMV30_02420
Transporters [BR:vbh02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/zinc/iron transporter
    CMV30_02420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZnuA DUF3053
Motif
Other DBs
NCBI-ProteinID: ATC65946
UniProt: A0A290QI05
Position
complement(569126..570043)
Genome map
AA seq 305 aa AA seqDB search
MRWNRWLLGVTLGVVTLAGAAGVLNAAPLRVVSTTAMVNDLVKRVGGAEVSAEVLMGPGV
DPHLYKATAADMLRLNRAEVVFYSGLMLEGKMTDVFTRMAKSGKRVNAITAGLPEAKLLK
PADFEGHPDPHVWFDVELWAMCVDVVEARLVEASPERKAVFAANAEKARGELAELHAWAK
AKAAELQVEKRVLVTSHDAYNYFGRAYGFQVVGLQGISTVSEAALADVAKLTDFIKQRGL
KAVFVESSVSHTTIERIAKDSGVTIGGELFSDAMGAAGKIENGYDVGTYEGMIKHNLNTI
VEALK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcgttggaatcggtggctgctcggtgtgacgctgggagtcgtgacgcttgcgggagcg
gcgggcgttttgaatgcggccccgctgcgtgttgtgagcacgacggcgatggtgaacgat
ttggtgaagcgcgtgggcggggccgaggtgagcgcggaggtgctgatggggccgggcgtc
gatccgcatttgtacaaggcgacagcggcggatatgttgagactcaaccgtgcggaggtg
gttttttatagcgggctgatgctggaggggaagatgacggatgtgttcacgcggatggcg
aagtcggggaagcgggttaacgcgatcacggcggggctgcctgaggcgaagctgttgaag
ccggcggattttgaagggcatcccgatccgcatgtgtggttcgatgtggagctgtgggcg
atgtgcgtggatgtggtggaggcgcggctggttgaggcgtcgccggagcggaaggcggtt
tttgcggcgaatgcggagaaggcgcgcggggaactcgcggagctccatgcgtgggccaag
gctaaggcggcggagttgcaggtggagaagcgcgtgctggtgacgagccacgatgcgtac
aactacttcgggcgtgcgtatggatttcaggtggtggggctccagggaatttccacagtg
agcgaggcggcgctggcggatgtggcgaagctgacggacttcatcaagcagcgcgggcta
aaggcggtgtttgtggagtcgagcgtgtcgcacacgacgatcgaacgcattgcgaaggac
tcgggcgtgacgatcggcggggaattgttttctgatgcgatgggcgcggcgggaaaaatc
gagaatggttacgacgtcggcacctatgaaggcatgattaaacataacctgaacacgatt
gtggaggcgttgaaatga

DBGET integrated database retrieval system