KEGG   Nibricoccus aquaticus HZ-65: CMV30_04275Help
Entry
CMV30_04275       CDS       T05426                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh00051  Fructose and mannose metabolism
vbh01100  Metabolic pathways
vbh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CMV30_04275
Enzymes [BR:vbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CMV30_04275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ATC63232
UniProt: A0A290QH88
Position
977603..978886
Genome map
AA seq 427 aa AA seqDB search
MDTTWLHPRDELVETMARIYRYKMTTTSGGNLSILDPNGDIWITPSRVDKGRLQPTDIVC
VHPDGKRTGLHPPSSEFPFHREIYRRRPDIKAIVHAHPGALVAFSICRKLPDTRVQTVAN
AVCGKVAYAPYACPGSEELGKNISETFAAGADCVMLENHGVVIGGTDLHDAFQRFETLEF
IAQTLVKAASLGEIKTLSAIELPERTVPDFAELPALPPSNREKELRTQICDFAHRAYQQR
LLISTVGSFSTRLENDRFLITPRRRDRLQLEPGALVVATRRACEPGKRPSRTALLHALIY
EQNPDVGAIINAQPSHASAFCMTSAELSTHTIPESYIVLNDAPKLPHACVVADAERIATE
VSLGKRPVVLIENEGALIVGKNVLDAFDRLEVLEATTEALFLARPLGPLVPMPESAIDEL
RKVFGVS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggacaccacctggctccacccacgcgacgaactcgtcgagaccatggcgcgcatctac
cgctacaagatgacgaccacctcgggcggcaacctgtcgatcctcgaccccaacggcgac
atctggatcacaccatcccgcgtcgacaaaggccgcctccagccgaccgatatcgtctgc
gtccaccccgacgggaaacgcaccggactccatccgccatcctccgagtttccctttcac
cgcgagatctaccgccgccgtcccgacatcaaggccatcgtccacgcgcatcccggcgcg
ctcgtcgccttcagcatctgtcgcaagcttcccgatacccgcgtgcaaaccgtcgccaac
gccgtctgcggcaaggtcgcctacgcgccctacgcctgccccggcagtgaggaactgggt
aaaaacatctctgaaaccttcgccgccggcgccgactgcgtaatgctcgaaaaccatggc
gtcgtcatcggcggcaccgacctgcacgacgcgtttcaacgtttcgagacgctggagttc
atcgcgcagacactcgtgaaggccgcctctctcggcgaaatcaaaaccctctccgccatc
gagctccccgagcgcaccgtccccgacttcgccgaactccctgcgctgcctccctccaac
cgcgagaaggaactccgcactcagatctgcgacttcgcccaccgcgcctatcaacaacgt
ctgctcatcagcaccgtcggctcgttctccactcgcctcgaaaacgaccgcttcctcatc
accccgcgccgtcgcgaccgcctgcaactggagcccggagcactcgtcgtcgccacgcgc
cgcgcctgcgaaccgggcaaacgccccagccgcaccgccctccttcacgcactgatctac
gagcaaaaccccgatgtcggcgcgatcatcaacgcccagccctcccacgcctccgccttc
tgcatgacctccgccgagctcagcacgcacaccattcccgaaagctatatcgtcctcaac
gacgcgcccaagctccctcacgcgtgtgtcgtcgccgacgccgaacgcatcgccaccgag
gtctcgctcggaaaacgccccgtcgtgctcatcgaaaacgagggcgcgctcatcgtcggg
aaaaatgtcctcgatgccttcgaccggctcgaagtcctcgaagccaccaccgaagcgctc
ttcctcgcacgcccgctcggtccgctcgtgcccatgcccgagtcggcgatcgacgagctg
cgcaaagtctttggcgtcagctaa

DBGET integrated database retrieval system