KEGG   Nibricoccus aquaticus HZ-65: CMV30_04530Help
Entry
CMV30_04530       CDS       T05426                                 

Definition
(GenBank) ABC transporter permease
  KO
K09690  lipopolysaccharide transport system permease protein
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CMV30_04530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbh02000]
    CMV30_04530
Transporters [BR:vbh02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    CMV30_04530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane DUF997
Motif
Other DBs
NCBI-ProteinID: ATC63279
UniProt: A0A290Q3N3
Position
1036834..1037712
Genome map
AA seq 292 aa AA seqDB search
MNPSQPPSEIEIRIRPNTSWFHIDLEGLKNYRDLLWLLVQRDFTSKYKQTILGPLWFLVS
PIINSLAFTLVFGKIVGVSTDKLPPMIFFLSGQLAWTYFSTVLGSTANSLAGNTHLFAKV
YFPRLIPPLAVTISSLLALVIQLVTFLGFYAHHQLTHSPDQLLALPSINWLLFPLIVVHM
AVLALGVGLTLSALSAKYRDIQQVQGFFVTLWMYGSPVIYPLSTISEKFPGFVWLAHLNP
MTAIVETTRFLFLGVGTVTLSGYATSVAITLAVFALGLFSYQKSARTFVDTV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccctcccagcctccctccgagatcgaaatccgcatccgtcccaacacgagttgg
tttcacatcgatctggaaggactcaaaaactaccgcgacctcctctggctcctcgtccag
cgcgacttcacctcgaagtacaagcagaccatcctcggtcccctctggtttctcgtcagt
cccatcatcaactccctggccttcaccctcgtcttcgggaaaatcgtcggcgtatccacc
gataaactcccgccgatgatcttcttcctcagcggccagcttgcctggacttacttctcc
accgtcctcggctccaccgccaactccctcgccggaaacacccacctcttcgccaaggtt
tatttcccccgcctcatccccccgctcgccgtcaccatctccagccttctcgcactcgtt
atccagctcgtcaccttcctcggcttctacgcccaccaccagctgacccattcccccgat
cagctccttgcgctgccctccatcaactggctcctcttccccctgatcgtcgtccacatg
gccgtcctcgccctcggcgtcggcctcaccctctccgccctctccgccaaataccgcgac
atccagcaagtccagggcttcttcgtcaccctctggatgtacggctcccccgtgatctac
ccgctctccaccatcagcgaaaaatttcccggcttcgtctggctcgctcacctcaacccc
atgacggctatcgtcgagaccacccgcttcctcttcctcggcgtcggcaccgtcaccctc
tccggctacgccacctccgtcgccatcaccctcgccgttttcgcgctcggactcttctcg
taccaaaaatccgcccgcaccttcgtcgacaccgtctga

KEGG   Nibricoccus aquaticus HZ-65: CMV30_12685Help
Entry
CMV30_12685       CDS       T05426                                 

Definition
(GenBank) sugar ABC transporter permease
  KO
K09690  lipopolysaccharide transport system permease protein
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CMV30_12685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbh02000]
    CMV30_12685
Transporters [BR:vbh02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    CMV30_12685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane DUF962
Motif
Other DBs
NCBI-ProteinID: ATC64749
UniProt: A0A290Q7X6
Position
complement(3172429..3173253)
Genome map
AA seq 274 aa AA seqDB search
MLRRLAPFLADLWQHRELLWQFTQRNVELRHKGSHLGLIWSFASPLMMLGLYVFVFGFIF
GGSFGVLPNETRTDYGLGIFFGLSLFHFASEVLAVSPTLIVSNPNFIKKVVFPVEILPAA
AVGAATFHLLVSLGLVLAGAALFGQGLDFGVLWLPVAVIPLLFAGLGISWLCSALGVFFR
DVSQIIQFLIAVLMFTSAVFYPAVRILEKAPPFVWAILQFNPLLLAIEIARDGVLWQRSP
NLYHVAYLWIVSIVICWLGHAAFKKMKPAFADVL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtcgtctggccccatttctcgccgacctctggcaacaccgggagctgctctgg
caatttacacagcgtaacgtagagctgcgccacaaaggcagccacctcggcctgatctgg
tccttcgccagcccgctgatgatgctgggcctttacgttttcgtcttcggcttcatcttc
ggtggcagcttcggcgttctgcccaatgagacccgcaccgactatggcctgggcatattt
ttcgggctcagcctttttcacttcgcgtccgaagtcctcgctgtttcccccaccctgatc
gtttcaaatcccaacttcatcaagaaggtcgtcttcccggtggagatccttcccgccgcc
gctgtcggcgccgctacttttcacctgctggtttccctcggcctcgtactcgcgggcgcc
gcattattcgggcagggactggatttcggcgtcctctggctgcccgtcgccgtcatccca
ctactcttcgcaggcctgggcatctcctggctgtgctcggcactcggcgtcttcttccgc
gacgtcagccagatcattcagttcctcatcgccgtgctcatgttcaccagcgcggttttc
tatcccgcagtccggatcctcgaaaaagcccccccgttcgtctgggccatcctgcaattt
aacccgctcctgctcgccattgaaatcgcacgcgacggcgtgctctggcaacgctcgccc
aacctctaccacgtcgcctacctatggatcgtcagcatcgtcatctgctggctgggtcac
gccgccttcaaaaaaatgaagcccgccttcgccgacgtcctctaa

KEGG   Nibricoccus aquaticus HZ-65: CMV30_18120Help
Entry
CMV30_18120       CDS       T05426                                 

Definition
(GenBank) phosphate ABC transporter permease
  KO
K09690  lipopolysaccharide transport system permease protein
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CMV30_18120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbh02000]
    CMV30_18120
Transporters [BR:vbh02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    CMV30_18120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane Tail_VII
Motif
Other DBs
NCBI-ProteinID: ATC65710
UniProt: A0A290QEQ1
Position
complement(4462785..4463753)
Genome map
AA seq 322 aa AA seqDB search
MGFVRHPRPRRHIFLFAFPRPPRLPPLRVNPLPATPVAPPAVAASASERSAPLVIEAGRA
DLHYWRDLWRYRELAVLLAWRDIQVRYKQAVLGITWALIQPAVQTVLLWFVFGKLAKMPA
GDESIPYPFLVLSGLLPWQLFSAAFNNAGNSLVGNSHLISKVYFPRLIMPLSALAVALLD
MLILLALTLPVMAAFDVWPTWRLLLLPLFTLGTLLIALGAGLWITALTVKFRDFRFIAPF
ILQIGMFVTPVGYRTDLLPNWRDLLALNPLTSMVEGFRWCLLGGRTQFDPSGLAISLPIT
ALLLITGLWYFRKTERHFSDVI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgggattcgtccgccatccgcgcccgcgccgacacattttcctattcgcgtttccgcga
ccacctcggctccctcctcttcgcgtgaatccccttcccgccactcccgtagccccgccc
gccgtagccgcgagcgccagcgagcggtccgcccccctcgtcatcgaagccggccgcgcc
gacctccactactggcgcgacctctggcgctaccgcgaactcgccgtcctcctcgcctgg
cgcgacatccaggtccgctacaaacaagccgtcctcggcatcacctgggccctcatccag
cccgccgtccagaccgtcctcctctggttcgtcttcggcaaactcgccaaaatgcccgcc
ggcgacgaatccatcccctatcccttcctcgtcctctccggcctgctcccctggcagctc
ttctccgccgccttcaacaacgccggtaactccctcgtcggaaattctcacctcatctcc
aaggtctatttcccgcgcctcatcatgccgctctccgcgctcgccgtcgcgctgctcgac
atgctcatcctgctcgcgctcaccctccccgtgatggccgccttcgatgtatggccaacc
tggagactcctcctgcttcccctcttcaccctcggcaccctcctcatcgccctcggcgcc
ggactctggatcaccgccctcaccgtcaaattccgcgacttccgtttcatcgccccgttc
atcctccagatcggcatgtttgtaacacccgtcggctaccgcaccgatctccttcctaac
tggcgcgacctcctcgccctcaatcccctcaccagcatggtcgaaggtttccgctggtgc
ctcctcggcggacgcacccaattcgatccctccggcctggccatttccctgcccatcacc
gcgctgctcctcatcaccggactctggtacttccgcaaaaccgaacgccacttttccgac
gtgatctaa

DBGET integrated database retrieval system