KEGG   Nibricoccus aquaticus HZ-65: CMV30_05680Help
Entry
CMV30_05680       CDS       T05426                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K09697  sodium transport system ATP-binding protein [EC:7.2.2.4]
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh02010  ABC transporters
vbh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CMV30_05680
  09132 Signal transduction
   02020 Two-component system
    CMV30_05680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbh02000]
    CMV30_05680
Enzymes [BR:vbh01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.4  ABC-type Na+ transporter
     CMV30_05680
Transporters [BR:vbh02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Sodium transporter
    CMV30_05680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SRP54 AAA_30 AAA_16 AAA_29 AAA_23 AAA_28 AAA_15 AAA_22 Thymidylate_kin DUF3584
Motif
Other DBs
NCBI-ProteinID: ATC63486
UniProt: A0A290QB85
Position
1345624..1346397
Genome map
AA seq 257 aa AA seqDB search
MIEARGLTKLFHDKKRGEIRAADNISFTLAPGQIYGLLGANGAGKTTTLRMLATLLKPTS
GTATVAGFDVATSPDKVRANVGFLAASTALYGRLTARELIAYFGRLNGLSDPEIAVRTAR
LSAELDMDEFLDRRIEKFSTGMKQKTSIARTLIHDPAVMIFDEPTLGLDVMAARTIVRFI
RDCRARGKTVIYSTHVMSEVEKLCDTIGIVHGGRLLDAGTLADLRARHGETDMEEIFVRV
VTSVTALSSSATPEARA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagcccgcggcctcaccaaactcttccacgataaaaaacgcggcgagatccgc
gccgccgacaacatcagcttcaccctcgcgcccggccagatctacggactcctcggcgcc
aacggcgcgggcaagaccactacgctccgtatgttggcgaccctcctcaaacccaccagc
ggcaccgccaccgtcgccggcttcgacgtcgccacttcccccgataaagtccgcgccaac
gtgggcttcctcgccgccagcaccgccctctacggccgactcaccgcccgcgaactcatc
gcctacttcggccgcctcaacggcctctccgaccccgaaatcgccgtgcgcaccgcccgc
ctctccgccgaactcgacatggatgaattcctcgaccgccgcatcgaaaaattctccacc
ggcatgaagcaaaaaacctccatcgcccgcaccctcatccacgatcccgccgtgatgatc
ttcgacgagcccaccctcggcctcgatgtcatggccgcccgcaccatcgtccgcttcatc
cgcgactgccgcgcccgcggcaaaaccgtcatctactccacccacgtcatgtccgaggtc
gaaaaactctgcgacaccatcggcatcgtccacggcggccgcctcctcgacgcaggcacc
ctcgccgacctccgcgcccgtcacggcgaaacggatatggaggaaatcttcgtccgcgtc
gtcacctccgtcaccgcactctcctcctctgcgaccccggaggcccgcgcatga

DBGET integrated database retrieval system