KEGG   Nibricoccus aquaticus HZ-65: CMV30_12135Help
Entry
CMV30_12135       CDS       T05426                                 

Gene name
pstC
Definition
(GenBank) phosphate ABC transporter permease subunit PstC
  KO
K02037  phosphate transport system permease protein
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CMV30_12135 (pstC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbh02000]
    CMV30_12135 (pstC)
Transporters [BR:vbh02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    CMV30_12135 (pstC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ATC64645
UniProt: A0A290Q7G4
Position
3037226..3038830
Genome map
AA seq 534 aa AA seqDB search
MATSITADTRPPFVIAKARTRFFGLSLDECIQSFFGGSAAVAVIVLGLITLFLFREGSAF
FTQNQKNLTVYRQAGLEYVDFIRQQERDHTALTRYLSDLRLRTLTHFTQVEKLSLADANA
RLADFDDYAGRYSDAVGPIRGFVSDLGDVATGIKTKFAVNEDRLIERSQLLAAGKTAEAA
ALVIAPIDFKTELQPILGALPAYKEASEAFAAELTALGASAPALPAPELQARMEKFKSLN
SAYIAGFPAVVKQLETWDYTLAVPFWQSFTAFVFGREWLTASFWQDWYGILPLLTGSLMV
SLVALVIAVPLGVGAAIYVNQIARPTEQKLIKPSIEFISAIPSVVLGFFGIAILGTFLRD
ISQVEWLQWLPGFPIAERLNVLTAGALLALISVPTIFTLAEDAINNVPRAFKEASFALGA
SKLQTTVKIIVPAALSGIISAVLLGFGRVIGETMVVLLCAGNRIAIPDFSAGLGAFTQPV
HTMTGIIAQEMGEVANGSIHYRALFVVGIGLFFLSLLINYVAQVIVRRYRISIG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccaccagcatcaccgccgacacccgcccgcccttcgtcattgcgaaggcgcgcacg
cgttttttcggcctctcgcttgatgagtgcatccagtctttcttcggcggcagtgcggcg
gtcgcagtcatcgtgctcggcctgatcacgctttttctgtttcgcgaaggctcggccttt
ttcacgcagaaccaaaaaaacctgaccgtgtaccggcaggcaggcctcgagtatgtcgac
ttcatccgccagcaggaacgcgatcacaccgcgctcacccgttacctctccgatctgcgt
ctgcgcacgctgacgcatttcacgcaggtcgaaaaactttccctggccgacgctaacgcg
aggctggcggacttcgacgattacgcaggccgttacagcgatgcggtcgggccgatccgc
ggcttcgtctctgatctcggggatgtcgccacgggcatcaaaacgaaattcgcggtcaac
gaagaccgcttgatcgagcgcagccagctgctcgccgcaggcaagacggccgaggccgct
gcgctggtgattgctcccattgatttcaaaaccgaacttcaacccatcctcggcgcgctg
cccgcctacaaggaggccagcgaggcgtttgccgccgagctgaccgcactgggcgcatcg
gctcctgcgctgcccgcgccggagctgcaggcccggatggaaaaattcaagagcctcaac
agcgcgtacatcgccggattcccggccgtggtgaaacaactggagacgtgggattacacg
ctcgccgttcccttctggcagtcgttcaccgcgtttgtttttggtcgtgagtggctgacg
gcgagcttctggcaggattggtacggcatcctcccactgctcacgggctcgctcatggtt
tcgcttgtcgcactcgtcatcgcggtgccgctcggtgtcggcgcggcgatctacgtgaac
cagattgcccggcccactgagcaaaagctgatcaagccatccatcgagtttatctcggcg
attccgtccgtcgtgctgggctttttcggtatcgcgattctgggcacgttcctgcgcgac
atctcccaagtcgagtggctgcaatggctgccgggtttcccgatcgccgagagactgaac
gtgctcacggcgggcgctctgctcgcgttgatctccgtgccgacgattttcacgctcgct
gaagacgccatcaacaacgtgccgcgcgctttcaaggaggcctccttcgcgctcggtgcg
agcaagctgcaaaccacggtgaagatcatcgtgcctgccgccctctcgggaatcatctcg
gcggtgctgctgggtttcgggcgcgtgatcggtgagacgatggttgtgctgctctgcgcg
ggtaaccgcatcgcgatcccggatttttccgccggtctcggtgcgtttactcagccggtc
cacacgatgacgggcatcatcgcgcaggagatgggcgaggtcgccaatggcagcatccac
taccgcgcgctcttcgtggtcggcatcggccttttcttcctctctctgctgatcaactac
gtggcgcaggtcatcgtccgccgctaccgcatctcgatcggataa

DBGET integrated database retrieval system