KEGG   Nibricoccus aquaticus HZ-65: CMV30_14575Help
Entry
CMV30_14575       CDS       T05426                                 

Gene name
urtC
Definition
(GenBank) urea ABC transporter permease subunit UrtC
  KO
K11961  urea transport system permease protein
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CMV30_14575 (urtC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbh02000]
    CMV30_14575 (urtC)
Transporters [BR:vbh02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Urea transporter
    CMV30_14575 (urtC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 DUF3042 PalH
Motif
Other DBs
NCBI-ProteinID: ATC65081
UniProt: A0A290QL17
Position
3617973..3619100
Genome map
AA seq 375 aa AA seqDB search
MTSPLSAPITSSKRLKIEIGVVAVIAIFLIVIFPLLNAWGMVSNFHVSLWGKYLCYALLA
ISVDLLWGYTGLLSLGQALFFSLGGYMMGMHLMLMIGELGKYAEAGKNPNGLPDFMIFLG
YTTLPDFWKPFFSFGFSMAMVVLIPGLVAYVFGFLAFRSRIKGVYFSILTQALTYCASLM
FFQNNLLMGGNNGFTDFKRILGHTFADPATYRWLYIATAITLVLVYVGCRVLSRTKFGMV
QQAIRDGENRVLFSGYAAAHFKLFVFVLAALIASVAGALFVPQAGIINPEEMKPEKSLEA
VVWVAVGGRATLAGPIIGAISINALKSWATRAFPDSWLLILGGLFIIVVLFLPGGIVSIP
GKISAFYKARFSKKS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacttctccgctctccgctcctatcacctcttccaaacgactgaaaatcgagatcggc
gtcgtcgccgtcatcgcgattttcctgatcgtgattttcccgctcctgaatgcgtggggc
atggtgagcaatttccatgtcagcctttggggaaaatatctttgctacgctctgctcgca
atctcggtggatctgctctggggctacacggggctgctcagcctcggccaggcgctcttc
ttcagtctaggcggctacatgatgggcatgcacctcatgctgatgatcggagaactcggc
aaatatgcggaggcggggaaaaaccccaacgggcttcccgatttcatgatcttcctcggg
tacacgacgctgcccgatttctggaaaccgtttttctccttcggattttcgatggcgatg
gtcgtgttgatacccggactggtcgcgtacgtgtttggattcctcgcgtttcgctcccgc
atcaagggcgtgtacttctcgatcctcacgcaggcgctgacctactgcgcgtcgctcatg
ttttttcagaacaacctgctcatgggcggcaacaacgggttcaccgatttcaagcgcatc
ctcggtcacaccttcgccgatcccgcgacctaccgctggctctacatcgcgacggcgatc
acgctcgtgctcgtctacgtgggatgccgcgtgctgagccgcacgaagttcggcatggtg
cagcaagcaatccgcgacggcgagaaccgcgtgctcttcagcggctacgcggccgcgcat
ttcaagctcttcgttttcgtcctggcggcgttgatcgcctcggtggctggtgcgctgttt
gtgcctcaagcgggcatcatcaatcctgaggagatgaagcccgagaaatccctcgaagcg
gtcgtgtgggtcgcagtcggcggacgcgccacgctggcgggcccgatcatcggtgcgatc
agcatcaacgcgctgaagagctgggccacccgcgcgtttcccgattcatggctgcttatc
ctcggcggccttttcatcatcgtggtgctcttcctgccaggcggcatcgtgagcattccc
ggcaaaatctccgccttctacaaagcgcgcttcagcaaaaaatcctga

DBGET integrated database retrieval system