KEGG   Variovorax boronicumulans: CKY39_01375Help
Entry
CKY39_01375       CDS       T05068                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
vbo  Variovorax boronicumulans
Pathway
vbo00480  Glutathione metabolism
vbo00590  Arachidonic acid metabolism
vbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CKY39_01375
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CKY39_01375
Enzymes [BR:vbo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CKY39_01375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ATA52024
UniProt: A0A1E7TXF0
Position
complement(302998..303486)
Genome map
AA seq 162 aa AA seqDB search
MTSVYDFQATRIDGKPVKLSTFRGKVLLIVNTASNCGFTPQFEGLEALHEKYAGQGLAVL
GFPSNQFGGQDPGTNEEIGAFCMTNYGVSFPMMEKIDVNGSNALPLYQWLTKEKPGLLGS
TAIKWNFTKFLVGRDGAVLKRYAPLDTPASLTRDIEAALAAG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgtctacgacttccaggccacccgcatcgacggcaagccggtgaagctctcg
accttccgcggcaaggtgctgctgatcgtcaacacggcgagcaattgcggcttcacgccg
cagttcgaaggcctggaagcgctgcacgaaaagtacgccggccagggcctcgcagtgctg
ggttttccctccaaccagttcggcggccaggacccgggcaccaacgaggaaatcggcgcc
ttctgcatgaccaactacggcgtgagcttcccgatgatggagaagatcgacgtcaacggc
agcaacgcgctgccgctgtaccagtggctcaccaaggaaaagcccggcctgctgggcagc
acggccatcaagtggaacttcaccaagttcctggtcgggcgcgacggcgcggtgctcaag
cgctatgcgccgctggacacgccggcctcgctcacgcgcgacatcgaggcggcgctggcc
gccggctga

DBGET integrated database retrieval system