KEGG   Variovorax boronicumulans: CKY39_05380Help
Entry
CKY39_05380       CDS       T05068                                 

Definition
(GenBank) 5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
vbo  Variovorax boronicumulans
Pathway
vbo00230  Purine metabolism
vbo00240  Pyrimidine metabolism
vbo00760  Nicotinate and nicotinamide metabolism
vbo01100  Metabolic pathways
vbo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CKY39_05380
   00240 Pyrimidine metabolism
    CKY39_05380
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CKY39_05380
Enzymes [BR:vbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     CKY39_05380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-nucleotidase POTRA_1
Motif
Other DBs
NCBI-ProteinID: ATA52706
UniProt: A0A1E7U6I8
Position
complement(1198947..1199846)
Genome map
AA seq 299 aa AA seqDB search
MPVTLEDKLVVAISSRALFNLEEENKIFEAGDNEGYMKLQLDRIDEPAAPGIASSLIRKL
LRFNEDGVQRVEVVILSRNDPVSGMRIFKSSAAADIKLQRGVFTQGRPPFGYLRPLRAHL
FLSVNAQDVREALAAGFPAARVLVESVKASDAWPNEVRIAFDGDAVLFSDEAERVFQAEG
LDAFQAHELSKADLPLPEGPFKPLLMALHRLQMAGNAQMRIRTALVTARSAPAHERAIRT
LMKWNIRVDEAMFLGGLPKGEFLREFEPDFFFDDQTGHVDAASRHVPAGHVSSGISNEP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtaacgctcgaagacaaactcgtggtcgcgatctcctcgcgggccctgttcaac
ctcgaagaagaaaacaagatcttcgaggccggcgacaacgagggctacatgaagctgcag
ctcgaccgcatcgatgaaccggccgcccccggcatcgcgtcgtcgctgatccgcaagctg
ctgcgcttcaacgaagacggcgtgcagcgcgtcgaggtggtcattctttcgcgcaacgac
ccggtgtcgggcatgcgcatcttcaagtcgagcgccgcggccgacatcaagctgcagcgc
ggcgtgttcacgcaaggccgcccgcccttcggctacctgcgcccgctgcgcgcgcacctg
ttcctgtcggtcaacgcgcaggacgtgcgcgaggcgctcgccgcgggctttccggccgcg
cgcgtgctggtcgagtcggtgaaagccagcgacgcgtggccgaacgaagtgcgcatcgcc
ttcgacggcgacgcggtgctgttcagcgacgaggccgagcgcgtgttccaggccgagggc
ctcgatgccttccaggcgcacgaactcagcaaggccgacctgcccctgcccgaaggcccg
ttcaagccgctgctgatggccttgcaccgcctgcagatggcgggcaacgcgcagatgcgc
atccgcaccgcgctggtcacggcgcgcagcgcaccggcgcacgagcgcgcgatccgcacg
ctcatgaaatggaacatccgcgtcgacgaagcgatgttcctcggcggcctgcccaagggc
gagtttctgcgcgagttcgagcccgacttcttcttcgacgaccagaccggtcacgtcgac
gcggcctcgcggcatgtgcctgcggggcatgtgtcgagcggcatcagcaacgaaccctga

DBGET integrated database retrieval system