KEGG   Variovorax boronicumulans: CKY39_06165Help
Entry
CKY39_06165       CDS       T05068                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
vbo  Variovorax boronicumulans
Pathway
vbo00630  Glyoxylate and dicarboxylate metabolism
vbo00710  Carbon fixation in photosynthetic organisms
vbo01100  Metabolic pathways
vbo01110  Biosynthesis of secondary metabolites
vbo01120  Microbial metabolism in diverse environments
vbo01130  Biosynthesis of antibiotics
vbo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CKY39_06165
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CKY39_06165
Enzymes [BR:vbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CKY39_06165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ATA52839
UniProt: A0A250DFT7
Position
complement(1373162..1374430)
Genome map
AA seq 422 aa AA seqDB search
MAAERIRARYLIETPVDLAAVAEVMAGEQSCGTFTRVEGETDALRERARATVEAIMELEP
VASPSLPNALLERKGTRGPWRRAHVDISFPVANIGANLPTLAATVSGNLYDLGEVTGLRL
ESLHVPSAYRAQFEMPRVGIAGTRRATGVASGALVGTIIKPNVGLSAAETAALVERLCAA
GVDFIKDDEVCAAPAHAPLAERVPAVMAVVRAHQERTGKHVMVAFNITDETDAMKRHADL
VERESGSSVMASLNWCGHSGIQTLRRHTGLALHGHRNGYGALSRHPLLGISFQAYQTLWR
LAGVDHMHVHGLQGKFSQPDSEVIESARDCFTPLNDVLDDRVMPAFSSGQWAGTVPATWA
AIGSDDLLFMAGGGILAHPDGAEAGVTSIRQAWSAARAGTTLADAAKHAPELARAFAFFG
KP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgaacgcatccgcgcgcgctacctgatcgagacgccggtggacctggcggcc
gtcgccgaggtgatggccggcgagcaatcgtgcggcaccttcacacgcgtggagggcgag
accgatgcgctgcgcgaacgtgcgcgtgcgacggtcgaagccatcatggagctggaaccc
gttgcatcaccgagcctgccgaacgcgctgctggagcgcaagggaacgcgtgggccgtgg
cggcgtgcgcatgtcgatatctcgtttcctgtcgcgaacatcggcgccaacctgccgacg
ctcgccgcgactgtttcaggcaacctctatgacctcggtgaagtgacggggctgcggctc
gaatcgctgcatgtgccgtctgcctatcgcgcgcagttcgagatgccgcgcgtcggcatc
gcgggcacgcggcgcgccacgggtgtggcgagcggcgcgctggtcggcacgatcatcaag
ccgaacgtggggctctccgccgcggagactgccgcactcgttgaacggctctgcgccgcg
ggcgtggacttcatcaaagatgacgaggtctgcgccgcccccgcgcacgcgccgctggcc
gaacgcgtgcccgccgtgatggcggtcgtgcgcgcgcaccaggagcgcaccggcaagcac
gtgatggtggccttcaacatcaccgacgaaaccgatgcgatgaagcgccatgccgatctc
gtggagcgcgaaagcggctcctccgtcatggccagtctcaactggtgcgggcactcgggc
atccagacgctgcgacgccacaccggcctggcgttgcatggccaccgcaatggctacggc
gccctgtcgcggcacccgctgctgggcatctcgttccaggcgtaccagacgctgtggcgc
ctcgcgggcgtggaccacatgcacgtgcacggcctgcagggcaagttctcgcagcccgac
agcgaggtcatcgagtcggcgcgcgactgcttcacgcccctcaacgatgtcttggacgac
cgcgtgatgcccgccttctcctcgggccagtgggcaggcaccgtacccgccacctgggcc
gccatcggcagcgacgacctgctcttcatggcgggcggcggcatcctcgcgcacccggac
ggcgcggaggccggcgtgaccagcatccgccaggcctggtcggccgcgcgcgcggggacc
acgctggcagatgccgcgaagcacgcgcccgaactggcgcgcgccttcgccttcttcggc
aagccatga

DBGET integrated database retrieval system