KEGG   Variovorax boronicumulans: CKY39_15985Help
Entry
CKY39_15985       CDS       T05068                                 

Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
vbo  Variovorax boronicumulans
Pathway
vbo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CKY39_15985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vbo02022]
    CKY39_15985
Two-component system [BR:vbo02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   CKY39_15985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C Phage_TAC_6 PrpR_N
Motif
Other DBs
NCBI-ProteinID: ATA54542
UniProt: A0A1E7U1B9
Position
complement(3477250..3477981)
Genome map
AA seq 243 aa AA seqDB search
MTQVPARTDKIVIVDDDARIRDLLRRYLTQEGFEVIVAEDGKALNRILLRDTVDLIVLDL
MMPGEDGLSVCRRLRAANDRTPIIMLTAKGEDVDRIVGLEVGADDYLGKPFNPRELLARV
HAVLRRRPPLEAPGAPSTENETVTFGPFAFDLGSRTLKKDGEELSLTTGEFAMLKALVRH
PRQPLSREKLAQLARGREFEPFDRSLDVQISRLRKLVESDAAAPRYIQTVWGVGYVFVPD
GTA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagttcccgctcgcaccgacaagatcgtgatcgtcgacgacgacgcccgcatc
cgcgacctgctgcgccgctacctgacgcaggaaggattcgaagtgatcgtggccgaggac
ggcaaggcgctcaaccgcatcctgttgcgcgacacggtcgacctgatcgtgctcgacctg
atgatgcccggcgaagacggcctctccgtgtgccgccgtctgcgtgccgccaacgaccgc
acgccgatcatcatgctcaccgccaagggtgaggacgtggaccgcatcgtcggtctcgaa
gtcggcgccgacgactacctcggcaagcccttcaacccgcgcgaactgctggcccgcgtg
cacgctgtgctgcgccgccgtccgccgctcgaggcgcccggcgccccctccaccgagaac
gagaccgtcactttcggcccgttcgccttcgacctcggctcgcgcaccctgaagaaggac
ggcgaagaactctcgctgaccaccggcgagttcgcgatgctgaaggcgctggtgcgccac
ccgcgccagccgctgtcgcgcgaaaagctggcccagctggcacgcggacgcgaattcgag
cccttcgaccgcagcctggacgtgcagatctcgcgcctgcgcaagctggtcgagtccgac
gccgcggcgccgcgctacatccagaccgtctggggcgtgggctacgtgttcgtgccggac
ggcacggcctga

DBGET integrated database retrieval system