KEGG   Variovorax boronicumulans: CKY39_22035
Entry
CKY39_22035       CDS       T05068                                 

Definition
(GenBank) protocatechuate 3,4-dioxygenase
  KO
K15755  2'-aminobiphenyl-2,3-diol 1,2-dioxygenase, large subunit [EC:1.13.11.-]
Organism
vbo  Variovorax boronicumulans
Pathway
vbo00621  Dioxin degradation
vbo01100  Metabolic pathways
vbo01120  Microbial metabolism in diverse environments
vbo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    CKY39_22035
Enzymes [BR:vbo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     CKY39_22035
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: ATA55607
UniProt: A0A250DMK0
Position
4756244..4757056
AA seq 270 aa
MAKIVSGAATSHTFGLPGNAADAAQRIADGMLEVGRRVRASRPDLLLIVSSDHLTNFNLD
FQIPWAVGLADSYLPLGDLGTRRVAYRGHREFATGLMHFAAAAGFDLIGVERLTPDHGIT
VPNEMINGDAGIPIVPIYINTVMQPIPTCARSFGLGRIIADYVASIDDTTRVAIVATGGL
SHWVCMPDSGRVNAEWDQSIIELVISGQGERLGQWTPEKITDHGGNGGLEIATWACMAGA
LRNARGEAIYYEAMTPWWTGMGGIFMTPQS
NT seq 813 nt   +upstreamnt  +downstreamnt
atggcaaagatcgttagtggcgccgccacgtctcataccttcgggcttcccggcaacgcc
gcggacgcggctcaacggattgccgacggcatgctcgaggttggccggcgagtccgcgcc
agcaggccggacctgctgctgatcgtctccagtgaccatctgaccaacttcaacttggat
ttccagatcccttgggcagtgggattggccgactcctatcttccgcttggcgatctggga
acccgtcgcgtggcttatcggggtcatcgcgaatttgccaccggattgatgcatttcgct
gctgccgccggctttgatctgatcggtgtcgaacggctcacgcccgaccacgggatcacg
gtaccgaacgaaatgatcaatggcgacgccggcatccccatcgtccccatctacatcaac
acggtcatgcagccgattccgacgtgcgcgcgcagcttcggactgggccggatcatcgcc
gactacgtcgccagcattgatgacacgacgcgcgtagcgatcgttgccaccggtgggcta
tcccattgggtttgcatgccggactccggccgggtcaatgccgaatgggaccaatcgatc
atcgaactggtgatttcgggtcaaggcgagaggctgggccagtggactcccgaaaaaatc
acggaccacggaggcaatggcggtttggagatcgccacctgggcctgcatggccggcgct
ttgcgaaatgcccgtggcgaagccatctactacgaagccatgacgccttggtggacgggc
atgggcggaatattcatgacgccccaatcctga

DBGET integrated database retrieval system