KEGG   Variovorax boronicumulans: CKY39_22250Help
Entry
CKY39_22250       CDS       T05068                                 

Definition
(GenBank) gluconolaconase
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
vbo  Variovorax boronicumulans
Pathway
vbo00053  Ascorbate and aldarate metabolism
vbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    CKY39_22250
Enzymes [BR:vbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     CKY39_22250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL Arylesterase Lactonase
Motif
Other DBs
NCBI-ProteinID: ATA55644
UniProt: A0A250DN12
Position
complement(4803415..4804296)
Genome map
AA seq 293 aa AA seqDB search
MTVKITRVGTTKDQLGESPCWDADAQALNWIDALAGTLWRLNPEAGLPERHPLPAPVGSI
APCRSQAVVVALRHTFARYDFATRTLAHLADIPVDHPKVRFNDGKCDPAGNFLAGTMHVD
RQAGERVEGGLYRLRPDLRVEQLADDIGFANGPCFSPDGRVLYLADSLERTLWAYDYDPS
GHLRNKREFAKTHAFDSGPDGATVDSQGFLWTVLTRAAKLARYAPDGTLERLVELPVSYP
TSICFGGPRLEHMYLTTISRSARLEGNQAQDGGLFLITGLPATGRLPHHFADV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagatcacccgggtcgggacgaccaaagatcaactgggcgagagcccctgc
tgggatgccgatgcacaggccctgaactggatcgacgcgctggccggcacgctgtggcgg
ttgaaccccgaggccgggttgcccgagcggcacccgttgcctgcgcccgtgggctcgatc
gcgccatgccgcagtcaggccgtcgtggtggcgctgcgccacacctttgcgcgctatgac
ttcgccacgcgcacgctggcgcacctggccgacattcccgtggaccatccgaaggtccgc
ttcaacgatggcaaatgcgatccggcgggcaacttcctggcgggcaccatgcacgtcgat
cgccaggccggcgagcgggtggagggcgggctctaccggctgcgccccgaccttcgcgtg
gagcagctggccgatgacatcggctttgccaacgggccttgcttcagccccgacggccgc
gtgctgtacctggccgacagcctggagagaaccctctgggcctatgactacgatccgagc
ggtcacctgcgcaacaagcgcgagttcgcgaagacgcacgcgttcgactccgggcccgac
ggggcgacggtggattcacaagggttcctctggacagtgctgacccgcgccgccaagctg
gcgcgctatgccccggacggcacgctggaacgcctcgtcgagctgccggtgagctatccc
acgagcatctgcttcggcgggccccgcctggagcacatgtacctgaccaccatttcacgc
agcgcgcggctggagggcaaccaggcgcaggatggcgggctgttcttgatcaccggcctg
cccgccacggggcgtctgccccatcacttcgccgacgtctag

DBGET integrated database retrieval system