KEGG   Variovorax boronicumulans: CKY39_31100Help
Entry
CKY39_31100       CDS       T05068                                 

Definition
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
vbo  Variovorax boronicumulans
Brite
KEGG Orthology (KO) [BR:vbo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CKY39_31100
Enzymes [BR:vbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     CKY39_31100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ATA57177
UniProt: A0A250DS41
Position
complement(6723930..6726062)
Genome map
AA seq 710 aa AA seqDB search
MKTTTTQPLSGRRLLAGALLCLGLTAPALAQTAASPQDRAGAAAKRVDGNFVRANAAKKT
PDWPSYGLDYAESRFSKLDQVNTGNVKQLGLVWSYNLESTRGVEATPLVVDGIMYVTASW
SIVHAIDTRTGQKIWTFDPQVDRTKGFRGCCDVVNRGVALYEGRVYVAAYDGRLIALDAA
TGQKVWEKNTIEGQKGSYTITGAPRVFKGKVIIGNGGAEYGVRGYVTAYDAKTGDQKWRW
FVVPGDPSKPFEDESMARAAKTWDPSGKYWEAGGGGTAWDSFAFDPELNLMYVGTGNGSP
WAAKARSPKGGDNLYLGSVVALDPDTGKYKWHYQETPGDNWDYTSTQSMILADVKLNGKA
RKVLLHAPKNGFFFVIDRTNGKFISAKNFVAVNWATGYDKNGRPIEVPAARQNEKPGDSI
PGPFGAHNWHPMSYNPQTGLAYLPAQHVPINLMDDKAWKFDENAPGRPHAALGWNLGKFA
NVEPPTSKPFGRLVAWDPIKQKEAWGVDYASPWNGGTLTTAGDLVFQGTADGRLVAYHAK
TGEKLWETPTGTGVVAAPATYMVDGKQYVSVAVGWGGVYGLAQRATERQGPGTVYTFAVG
GTAKMPAFVEYRMAKLVQGVKYDPAKVQAGTMLYVSNCVFCHGVPGVDRGGNIPNLGYLD
PAYIENLDKFVLKGPAMSRGMPDFTGKLSGDDIESIKAFIQGTADAIRPK
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgacaacgacacagcctctttccgggcggcgcctgcttgcgggcgccttgctg
tgcctgggcctgacggccccggcgctggcccagacggccgccagcccgcaggaccgcgcc
ggcgcggccgccaagcgcgtcgacggcaacttcgtgcgcgccaacgcggcgaagaagacg
cccgactggcccagctacgggctcgactacgccgagtcgcgcttcagcaaactcgaccag
gtcaacaccggcaacgtgaagcagctcgggctggtctggtcgtacaacctcgaatcgacg
cgcggcgtggaagccacgccgctggtggtcgacggcatcatgtacgtcacggcctcgtgg
agcatcgtgcatgcgatcgacacgcgcaccgggcagaagatctggaccttcgatccgcag
gtcgaccgtacgaaaggcttcaggggctgctgcgacgtggtcaaccgcggcgtggcgctg
tacgaaggccgcgtctacgtggccgcctacgacggccgcctgatcgcgctcgacgccgcc
accggccagaaggtgtgggagaagaacaccatcgagggccagaagggcagctacaccatc
accggcgcgccccgcgtgttcaagggcaaggtcatcatcggcaacggcggcgccgagtac
ggcgtgcgtggctacgtcaccgcctacgacgcgaagaccggcgaccagaaatggcgctgg
ttcgtggtgcccggcgacccgagcaagcctttcgaagacgagtcgatggcgcgcgccgcc
aagacctgggacccgagcggcaagtactgggaagccggcggcggcggcaccgcgtgggac
agcttcgccttcgaccccgaactcaacctgatgtacgtgggcaccggcaacggctcgccc
tgggcggccaaggcgcgcagccccaagggcggcgacaacctctacctgggctcggtggtc
gcgctcgaccccgacaccggcaagtacaagtggcactaccaggagacgcccggcgacaac
tgggactacacctcgacgcagtcgatgatcctggccgacgtcaagctgaacggcaaggcg
cgcaaggtgctgctgcatgcgcccaagaacggcttcttcttcgtcatcgaccgcaccaac
ggcaagttcatctcggcgaagaacttcgtcgcggtcaactgggccacgggctacgacaag
aacggccggccgatcgaggtccccgccgcgcggcagaacgagaagccgggcgacagcatc
ccgggcccgttcggcgcgcacaactggcacccgatgtcctacaacccgcagaccggcctg
gcctacctgcccgcccagcacgtgccgatcaacctgatggacgacaaggcctggaagttc
gacgagaacgcgcccggccggccgcacgcggcgctgggctggaacctgggcaagttcgcc
aacgtcgagccgcccacgagcaagcccttcggccgtctcgtggcttgggaccccatcaag
cagaaggaagcctggggcgtcgactacgcctcgccgtggaacggcggcacgctgaccacc
gccggcgacctggtgttccagggcacggccgacgggcgcctggtggcctaccacgcgaag
accggcgagaagttgtgggaaacgcccaccggcaccggcgtggtggcggcgcccgcgacc
tacatggtggacggcaagcagtacgtgtcggtggccgtgggctggggcggcgtgtacggc
ctggcgcagcgcgccaccgagcgccagggcccgggcacggtctacaccttcgcggtcggc
ggcacggccaagatgcccgcgttcgtcgagtaccgcatggccaagctggtgcagggcgtg
aagtacgaccccgccaaggtccaggccggcaccatgctgtacgtgagcaactgcgtgttc
tgccacggcgtgccgggcgtggaccgcggcggcaacatcccgaacctgggctacctcgac
ccggcctacatcgagaacctcgacaagttcgtgctcaagggcccggccatgtcgcgcggc
atgcccgacttcacgggcaagctctcgggcgacgacatcgagagcatcaaggccttcatc
cagggcacggcggacgcgatccggccgaagtag

DBGET integrated database retrieval system