KEGG   Vibrio breoganii: A6E01_00795Help
Entry
A6E01_00795       CDS       T04649                                 

Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
vbr  Vibrio breoganii
Pathway
vbr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vbr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A6E01_00795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vbr02022]
    A6E01_00795
Two-component system [BR:vbr02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   A6E01_00795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: ANO31824
UniProt: A0A193K927
Position
1:complement(159673..160392)
Genome map
AA seq 239 aa AA seqDB search
MQENFKILVVDDDARLRSLLERYLSEQGFHVRSVANADQMDRLLTRENFNLMILDLMLPG
EDGLSICRRLRSANNMLPILMLTAKGDEIDRIVGLEVGADDYLPKPFNPRELLARAKAVL
RRQSVEAPGAPSSEEAIVEFGEFALNLGTREMYRGEELIPLTSGEFAVLKILVTNAREPM
SRDKLMNLARGREYSAMERSIDVQISRLRRILEEDPSHPRYIQTVWGLGYVFVPDGRKV
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaatttcaagattttggtcgtcgatgacgatgcacgcctccgctctctatta
gagcgttatctttctgagcaaggctttcatgtccgttctgttgccaatgctgatcagatg
gatcgcctgctaacccgtgaaaattttaacttaatgatattggaccttatgctgccggga
gaagatgggctatctatctgccgtcgcttgcgtagtgccaataacatgctacctattctg
atgcttaccgctaaaggtgatgagatcgataggattgttggcttagaagtcggggcggat
gattacctaccaaaaccattcaacccaagagagctactagctcgtgcaaaagcggtattg
cgtcgtcaatctgttgaagcaccaggcgcaccgagctcagaagaagctatcgtagaattt
ggcgaatttgcgctaaacctaggtactcgcgaaatgtatcgtggcgaagagctaatccct
ctcacctctggtgaatttgcggttcttaagatccttgtaacgaatgctcgtgaaccaatg
tcacgcgacaagctaatgaatctagctcgtggtcgtgaatactcggcaatggaacgctca
atcgacgtacagatctctcgtctgcgccgtattcttgaggaagatccaagccacccacgc
tacatccaaactgtatggggcctaggctacgtctttgttccagacggtcgtaaagtttaa

DBGET integrated database retrieval system