KEGG   Vibrio breoganii: A6E01_11205Help
Entry
A6E01_11205       CDS       T04649                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
vbr  Vibrio breoganii
Pathway
vbr00051  Fructose and mannose metabolism
vbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A6E01_11205
Enzymes [BR:vbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     A6E01_11205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UPF0052 3HCDH_N ApbA Sacchrp_dh_NADP CDI
Motif
Other DBs
NCBI-ProteinID: ANO33752
UniProt: A0A193KDX7
Position
1:2418198..2419346
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIAVTFADVNETVVNALIERNEYSVKVVGADCVVDTV
SNVTAVNSTSPEVVNCIAESDMVTTAVGPTVLNIISKTIAQGLELRFSQGNEAPLNIIAC
ENMVRGTTQLKEAVYGHLSDEAQAKADQYVGFVDSAVDRIVPPAEEGETDPLAVTVETFS
EWIVDQTQFKGEIPNIPGMECTDNLMAFVERKLFTLNTGHLITAYLGVLAGHETIKDSIE
DPAILAEVQAAMEESGEVLIRRYGFDPEAHAAYIQKILGRFANPFLRDEVDRVGRQPIRK
LSPQDRLIKPLNGTLEYNLPNTHLLKGIAAAFHYKNDDDPQAVELQAMFAEKGFAETLAH
YSELNVDAEVVKLAEQAYLAIK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttacattttggcgcaggtaacattggtcgtggttttatcggtaagctgctt
gctgacgctggtatcgcagtgacatttgcagatgtaaatgaaactgtagtgaacgctctt
atcgagcgaaatgaatattcagttaaggttgttggcgcagattgtgttgtagacacagtt
tcaaacgtaaccgctgttaactcaactagccctgaagttgtgaactgcattgcagagtca
gacatggtgacaactgcagtaggaccaacggttctaaacatcatctcaaaaaccatcgca
caaggccttgagctacgtttctcacaaggtaatgaagcaccactaaacatcattgcttgt
gaaaacatggtacgtggtacgactcagcttaaagaagccgtttacggccacctaagtgat
gaagcacaagcgaaagccgaccaatatgtaggctttgttgattcagcagtagaccgtatc
gttccaccagcagaagaaggtgaaacggacccactagccgtgaccgttgaaacctttagt
gagtggatcgtcgatcaaactcaattcaagggcgagattcctaacatccctggtatggaa
tgcactgataacctaatggcatttgttgagcgtaaactatttaccctgaacactggccac
ttaatcactgcatatctcggcgttcttgcaggtcacgagaccatcaaggattctatcgaa
gatcctgcgattcttgcagaagtacaagcggcaatggaagaaagtggtgaagtattgatt
cgtcgctacggcttcgaccctgaagctcacgctgcttacattcaaaagattcttggtcga
ttcgccaacccgttccttcgtgatgaagtggatcgcgtaggccgccaacctattcgtaag
ctaagccctcaagaccgtttgatcaagccgcttaacggtactctagagtacaacctaccg
aacacgcacctgctaaaaggtatcgctgctgcattccattataagaatgacgacgatcca
caagcagttgaacttcaagctatgtttgctgaaaaaggctttgctgagacattagcgcac
tactctgagctgaatgttgatgctgaagttgttaaactagcggaacaagcttacctagcg
attaaatga

DBGET integrated database retrieval system