KEGG   Vibrio breoganii: A6E01_15145Help
Entry
A6E01_15145       CDS       T04649                                 

Definition
(GenBank) NAD(P)H-dependent oxidoreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
vbr  Vibrio breoganii
Pathway
vbr00633  Nitrotoluene degradation
vbr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vbr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    A6E01_15145
Enzymes [BR:vbr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     A6E01_15145
  1.-  
   1.-.-  
    1.-.-.-  
     A6E01_15145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: ANO34535
UniProt: A0A193KGY0
Position
2:480239..480898
Genome map
AA seq 219 aa AA seqDB search
MSHPIIKDLNSRYTAKKYDTNKRISAEDMDVIKEAIRLSASSINSQPWKFIVIESDAAKQ
RFHDTFANMHQFNQPHAKEASHVILFAHNPNYTKDDYRKVVDVEVSSGHLPADMYDNMLN
GAYGFAELNTDESGFNGNWTKAQTYIAVGNTLHVLARMGIASTPMEGVDPDLIGEAFAEE
LNGFQCDFALAIGYHLEGEDYNYGKPKARLATEDVITVV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacccaatcattaaagacctaaacagccgttacacagcaaagaaatacgataca
aacaagcgcatttcagctgaagatatggatgttatcaaagaagccatccgtttgtcagct
tcttctatcaactcacagccttggaagtttattgtgattgagagtgatgcggctaagcag
cgtttccatgacacttttgccaacatgcaccaatttaaccagcctcacgctaaagaagcg
tcgcacgttatattgtttgctcacaacccgaactacacaaaagatgactaccgcaaagtt
gtcgatgtagaagttagctctggccacctaccagcagacatgtacgacaacatgctaaac
ggcgcttacggttttgctgagctaaacactgacgagagcggcttcaacggcaactggact
aaggctcaaacctacattgctgttggtaacacgctgcacgttctagctcgcatgggcatc
gcatcgactccgatggaaggtgttgaccctgaccttatcggtgaagcatttgcagaagag
ctaaacggtttccagtgtgatttcgcactcgctatcggttaccacctagaaggtgaagac
tacaactatggcaagccaaaagcgcgcctagcaacagaagatgttattactgttgtttaa

DBGET integrated database retrieval system