KEGG   Vibrio campbellii: M892_01730
Entry
M892_01730        CDS       T02837                                 

Definition
(GenBank) Ter macrodomain organizer matS-binding protein
  KO
K09911  uncharacterized protein
Organism
vca  Vibrio campbellii
Brite
KEGG Orthology (KO) [BR:vca00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    M892_01730
SSDB
Motif
Pfam: MatP MatP_C FAS_I_H CcdA RHH_4 APG6_N
Other DBs
NCBI-ProteinID: AGU93872
UniProt: A7N0M1
Position
I:410118..410567
AA seq 149 aa
MKYQQLENLECGWKWKYLIKKWKDGEAVTRYIDTSEADAAIAELRKLEHEPTQVLAWIEN
HMSEALDNKLKQAIRAKRKRHFNAEQVHTKKKSIDLDYRVWEKLSNRANELGCTLSDAIE
YLLSEASRSEKASMKVSSLKEDLSKLLSS
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaaatatcagcagcttgaaaatttagaatgtggttggaaatggaagtatctcattaaa
aagtggaaagatggtgaagccgttactcgatacatcgatacaagcgaagccgatgctgcg
attgctgaacttcgtaaactcgagcatgaacctactcaagttcttgcttggattgagaac
cacatgtcagaagcgcttgataacaagctgaaacaagcgatccgtgcaaagcgtaaacgt
catttcaatgcggagcaagtccacacaaagaaaaaatccatagatcttgactatcgagtg
tgggaaaagctctctaacagagcaaacgagctaggttgcacactatccgatgccattgag
tatttgctgtcagaagcatctcgaagcgagaaagcgagcatgaaggtatcatcgttgaaa
gaagacttgagtaaattgttgtccagctaa

DBGET integrated database retrieval system