KEGG   Vibrio campbellii: M892_04975Help
Entry
M892_04975        CDS       T02837                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vca  Vibrio campbellii
Pathway
vca00071  Fatty acid degradation
vca00072  Synthesis and degradation of ketone bodies
vca00280  Valine, leucine and isoleucine degradation
vca00310  Lysine degradation
vca00362  Benzoate degradation
vca00380  Tryptophan metabolism
vca00620  Pyruvate metabolism
vca00630  Glyoxylate and dicarboxylate metabolism
vca00640  Propanoate metabolism
vca00650  Butanoate metabolism
vca00900  Terpenoid backbone biosynthesis
vca01100  Metabolic pathways
vca01110  Biosynthesis of secondary metabolites
vca01120  Microbial metabolism in diverse environments
vca01130  Biosynthesis of antibiotics
vca01200  Carbon metabolism
vca01212  Fatty acid metabolism
vca02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M892_04975
   00630 Glyoxylate and dicarboxylate metabolism
    M892_04975
   00640 Propanoate metabolism
    M892_04975
   00650 Butanoate metabolism
    M892_04975
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M892_04975
   00072 Synthesis and degradation of ketone bodies
    M892_04975
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M892_04975
   00310 Lysine degradation
    M892_04975
   00380 Tryptophan metabolism
    M892_04975
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M892_04975
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M892_04975
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M892_04975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vca04147]
    M892_04975
Enzymes [BR:vca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M892_04975
Exosome [BR:vca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M892_04975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGU94166
UniProt: A7MTK9
Position
I:complement(1086452..1087639)
Genome map
AA seq 395 aa AA seqDB search
MENKDVFVISAYRTPLGSFGGALSGIPATELGAIVIKFMLDQHDIDAAHVDEVIVGQVLT
AGCGQNPARQTAIIAGIPEYSSAFTINKVCGSGLKALQLAYQAIKNGDADLVIAGGQENM
SQAPHILPNSRNGVKMGGWKAEDSMIKDGLWDVFNDYHMGKTAENIANQYDISREEQDEF
AYKSQMKAAYAIKNNRFKDEIVPVVVPHKRNDSLVFVEDEFPRPATTKDVLSKLRPAFDE
VGSVTAGNASGVNDGAAMVILASERKVQELGLNPIARLVNFATAGVDPAIMGTGPINASR
KVLDKCDWSIGELDLIESNEAFAAQAIAVNQEMQWDSNKVNVNGGSIAFGHPIGASGARI
FVTLVNELKRQKLKKGLATLCIGGGMGIAATVEML
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaagatgtttttgttataagtgcatatagaacaccattaggttcttttggt
ggggcactttctggtattccggcaactgagttgggtgcaatagtgataaaatttatgtta
gatcagcatgatattgacgctgctcatgtagatgaagtgatcgtcgggcaagtattgact
gctggctgcggacaaaacccggcccgccaaactgcaatcattgctggtattccagagtat
tcttcagctttcacaattaataaggtctgtggttcaggattaaaagctctacagcttgct
tatcaggctattaaaaatggagacgcagacctagtgattgcagggggacaagagaatatg
agtcaagcccctcatattctgccaaattcacgcaacggtgtgaaaatggggggatggaaa
gctgaagatagtatgatcaaagatggcctatgggatgtatttaacgactatcatatgggc
aaaactgcagaaaacattgcaaatcaatacgatatatctcgtgaagaacaagatgaattt
gcttacaagtcccagatgaaggcagcgtatgcaataaaaaacaaccgattcaaggacgaa
attgttccggttgtcgtgcctcataaacgcaatgattcccttgtttttgttgaagacgaa
tttccgcgcccagctaccaccaaagatgttttatcaaaactccgtcctgcatttgatgaa
gtaggtagtgtaactgcggggaatgcttctggagtcaatgatggagctgcgatggttatt
cttgcgtctgaacggaaagtacaagaattaggcttaaacccgattgctcgtcttgtgaat
tttgctactgccggagttgatcctgccattatggggactggaccaatcaatgcttctcgc
aaagtcttagataaatgcgattggagtattggagagctagaccttattgagtccaacgag
gcgtttgctgctcaagctatcgcggtaaaccaagaaatgcaatgggatagcaataaggtc
aatgtcaatggaggctctattgcatttgggcatccaattggagcctctggcgctcgtatt
tttgtcactctagtcaatgaattgaaacgtcagaaactcaaaaaggggttagcgacttta
tgtattggaggcgggatgggaatcgctgccaccgtagaaatgctttaa

DBGET integrated database retrieval system