KEGG   Vibrio campbellii: M892_10090
Entry
M892_10090        CDS       T02837                                 

Definition
(GenBank) S-type Pyocin family
Organism
vca  Vibrio campbellii
SSDB
Motif
Pfam: Pyocin_S LysM
Other DBs
NCBI-ProteinID: AGU96639
UniProt: A7MTX8
Position
I:2199433..2202012
AA seq 859 aa
MSHEFGLIEGNFHNLSEADVVSAIPAHLTFEQLKQHLHEGKLVLVSDTPQIPALLSYNDP
IGPKTWRLNSEVISAFSDDATKELLAKTKIPRVTGGYSTRIVETATLERAYTPQPIATES
EEEITKEFEYSFEVGCSDATIKKMVHSDFALAKTEKENAVTRWEQTKTEQGTRYTALCVF
DEPKRLNIHIADDNLGLTPLEAITLQKAGSHKTEEGFIPVVPAVRLGERLGLPTEGYYYH
LNDGELVQEYKILGQEKWAFYATRSTQDKLNDERGFTKDQSAILVYWKLANQVLENQYII
YLERQITREELDNLSEDWLSENGIKLDIPALFDVAKQPEEARVEDNNDETEAEQTAATHI
VVAGETWQSIAERYGMGAKALLSLNPVFEADPLSLTIGDEIVVAEAQQKQTPDKKNTFPP
LRPQTYNNIRNSHYQHSDPLLGLTKYRAINAADFVEGDVAILNLKDATSSLVFAKSCTRP
EGCIEIGDQQESISNFGPWSFFFAQANATPAAVIPAIQATQAQMAMGSSAAVAGSPEQTQ
QTQTAAMQLDKLAGTLKDKIVEGYRWQVEGIGALFAMQQNLFGDNTQYTDQDLRQVTTAQ
SRVRVHITEPQDGEFYPHVQGYHVDDTRIPIKYVKQGNNGQLSVAIEDNGPTIYWTPEEN
GEASWQTTPDHSDDFEKEDILVTPIHSDGDANVTVTPAPEEKDWRDAILVFPESSGIAPL
YVVYKESPRDKPGVVTGKGEDIFGIWLAGAGKDLGAPIPSQIADKLRGKEFSSFDAFRKA
FWLEVSKDSDLKGQFNAQNQIRIGLGKAPKARSRDKVGKRKSFELHHVDEVQNGGKVYDL
DNLKVTTPKNHIDIHRGMK
NT seq 2580 nt   +upstreamnt  +downstreamnt
atgtcccatgaattcgggttgatagagggcaacttccacaacctttcggaagcagatgtc
gtctctgctattcctgctcatcttacctttgagcagctaaaacaacacctccacgagggt
aagctcgtacttgtgagtgatacacctcaaattcccgcacttctgagttacaacgaccca
attggtcctaaaacatggcgcctaaactctgaggttatctctgcattttcggatgatgcg
actaaggagttgttagcaaagactaaaatccccagagtaacgggagggtacagcacacgt
attgtagagaccgcgacactcgaacgagcttacacgccgcagccaatagcaaccgaaagt
gaagaggaaatcaccaaggaattcgagtacagcttcgaagttggctgctcggatgccacc
ataaagaaaatggtgcacagtgactttgctttagcgaaaactgaaaaagagaacgcggtg
actcgctgggaacaaaccaaaaccgagcaaggcacccgctacacagcgttatgtgtgttt
gatgagccaaagcgtttaaatatccatattgctgatgacaacctcgggctgacaccactt
gaagccatcacactacaaaaagctggcagccataaaactgaggaaggttttatacctgtt
gttccggctgtgcgattgggcgaacgcctaggcttgccgacagaaggctattactaccac
ttaaatgatggtgaactggtccaagagtacaaaattctcggacaagaaaaatgggcgttt
tacgctacgcgatcgacacaagacaagctcaatgatgagcgtggttttaccaaagaccaa
agcgctatattggtgtattggaagttggccaaccaagtccttgagaaccaatacatcatt
tatcttgagcgccaaatcacacgagaagagctcgataacctcagtgaagattggctgagt
gaaaacgggataaagttggatattcctgcactgtttgatgtagctaaacagccggaagaa
gcacgcgtagaagataacaacgatgagacggaagcagaacaaaccgcagcaacgcacatc
gtagttgcaggggaaacctggcagagcatcgctgaacggtatggtatgggagcgaaagcc
ttgctctcgcttaacccagtgtttgaggccgaccctctatcactcacaattggtgatgaa
attgttgttgcagaagcacagcaaaaacaaacaccggacaaaaagaacacttttccgcct
ctgcgcccgcaaacctacaacaacatccgcaacagtcattaccaacacagcgatccattg
cttgggttgaccaaataccgagccatcaacgccgctgatttcgtcgaaggtgatgtcgcc
atccttaacttaaaagacgccacaagctcgctcgtgttcgctaaatcctgcaccaggcca
gaagggtgtattgaaattggtgaccaacaagagtcaatcagtaacttcgggccttggtca
ttcttttttgcacaagcgaatgcgaccccagcagctgtcatacccgccattcaagcaaca
caagcacaaatggccatgggaagttccgcagctgtcgccggctcaccagagcaaacgcag
caaacccaaactgcggcgatgcagttggataaactggcaggaacattgaaagacaaaatc
gttgagggctaccgctggcaagtagaaggcattggcgccttgtttgccatgcagcaaaac
ttatttggcgataacacccaatacacagaccaagatttgcgccaagtgaccacggcgcaa
agccgcgttcgtgtccacattaccgagccccaagatggagagttttacccgcacgtgcag
ggctatcatgtagacgacacgcgtatccccatcaaatacgtgaaacagggaaataatggc
caactgtccgttgcgattgaagataacggaccaaccatctattggacaccagaagaaaac
ggtgaagcaagttggcaaactactcccgatcatagtgatgactttgaaaaagaagatata
ctcgtcacgccaatccactcggatggcgatgcgaacgtcaccgttacgcctgcgccggaa
gagaaagactggcgtgatgcgatcttggtattcccggaaagctcaggtattgcaccgctc
tatgtggtttacaaagaaagcccgagggataagcccggagtcgttaccgggaaaggcgaa
gatatctttggcatttggttggcaggtgcaggtaaggacttaggagccccaataccgtct
caaattgcagataagctgagaggaaaagaattcagcagctttgatgcgtttcgaaaagca
ttctggttagaggtatctaaagacagcgatttaaagggacaatttaatgcacaaaaccaa
attcgaatcgggttagggaaggctcctaaagcaagaagtcgagataaagtaggaaagaga
aaatcttttgagctacatcatgtagatgaagtgcagaatggtggcaaggtttacgattta
gataatttaaaagtgaccacacccaaaaatcatattgatattcatagaggtatgaagtga

KEGG   : VIBHAR_00543

  All links  
DBGET integrated database retrieval system