KEGG   Vibrio campbellii: M892_10540Help
Entry
M892_10540        CDS       T02837                                 

Gene name
dnaA
Definition
(GenBank) chromosomal replication initiation protein
  KO
K02313  chromosomal replication initiator protein
Organism
vca  Vibrio campbellii
Pathway
vca02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M892_10540 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vca03032]
    M892_10540 (dnaA)
   03036 Chromosome and associated proteins [BR:vca03036]
    M892_10540 (dnaA)
DNA replication proteins [BR:vca03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    M892_10540 (dnaA)
Chromosome and associated proteins [BR:vca03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    M892_10540 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA AAA_16 AAA_14 AFG1_ATPase NACHT Kinesin DUF815 ATPase_2 AAA_19 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AGU94937
UniProt: A7N1E9
Position
I:complement(2298487..2299893)
Genome map
AA seq 468 aa AA seqDB search
MSSSLWLQCLQQLQEELPATEFSMWVRPLQAELNDNTLTLFAPNRFVLDWVRDKYLNSIN
RLLQEYCGNDVPSLRFEVGSRPVAAPKPAPTRTPADVAAESSAPAQLQARKPVHKTWDDD
AQAIADINHRSNVNPKHKFNNFVEGKSNQLGLAAARQVSDNPGAAYNPLFLYGGTGLGKT
HLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQF
FANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPEL
ETRVAILMKKAEDHQIHLADEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFV
REALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTN
HSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLIRTLSS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcttcgctttggttgcaatgtttgcagcagcttcaagaagagctaccagctaca
gaattcagcatgtgggttcgtccgttacaagcggagctcaatgacaatactctcactctg
ttcgcacctaaccgcttcgtgttggattgggttcgcgacaagtacctgaacagcatcaat
cgtttactgcaagaatactgcggtaacgacgtacctagcctgcgctttgaagtgggcagt
cgcccagttgcagcaccaaaaccggcaccgacacgtacgccggcagacgtggctgcagaa
tcttcagcgcctgctcaactgcaagcacgtaagcctgtgcataaaacgtgggatgacgac
gcgcaagcgatcgctgacatcaaccaccgctcaaacgtgaacccaaaacacaagttcaac
aacttcgtagaaggtaagtcgaaccaattgggtcttgctgctgctcgtcaagtttcggat
aacccaggcgcagcctataacccactattcttatacggtggtacaggtttgggtaaaacc
caccttttgcacgcggtaggtaacgcgattgtggataacaatcccaacgcaaaagtggtg
tacatgcactctgagcgttttgtgcaagatatggtgaaagcactgcaaaacaacgcgatt
gaagaattcaaacgctactaccgcagtgttgatgcgctacttatcgatgacatccaattc
tttgctaataaagagcgctcacaagaagaattcttccataccttcaatgcactattagaa
ggtaaccaacagatcatcctgacatctgaccgttatccaaaagagatcagcggtgtagaa
gatcgtctgaaatcacgtttcggttggggtctaaccgtcgcgatcgagccgcctgagtta
gaaactcgtgtggcgatcttgatgaagaaagctgaagaccaccaaatccacttagcggat
gaagtggcgttctttattgctaagcgtctacgctctaacgttcgtgaactggaaggtgca
ctgaaccgcgtaatcgcaaacgcaaactttactggccgcccaattacgattgattttgtt
cgtgaagcgctgcgcgatctgcttgctctgcaagagaaattggtgacgatcgataacatt
caaaagacggtcgctgaatattacaagattaaggttgctgacctactatctaaacgtcgc
tctcgctcggttgctcgtcctcgtcagttggcgatggcgttggcaaaagagttgaccaat
cacagcttgccagaaattggcgatgcgtttggtggtcgtgaccacaccacggtgctgcat
gcatgtcgcaagattgagcagctgcgtgaagagagccacgatattaaagaagattactct
aacttgattcgcaccctgtcttcgtaa

DBGET integrated database retrieval system