KEGG   Vibrio campbellii: M892_13635Help
Entry
M892_13635        CDS       T02837                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
vca  Vibrio campbellii
Pathway
vca00620  Pyruvate metabolism
vca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M892_13635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vca02000]
    M892_13635
Enzymes [BR:vca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     M892_13635
Transporters [BR:vca02000]
 Other transporters
  Primary active transporters [TC:3]
   M892_13635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AGU95372
UniProt: A7MYU4
Position
I:2930931..2932712
Genome map
AA seq 593 aa AA seqDB search
MSKPLAITDVVLRDAHQSLFATRMRIEDMLPIAAELDKVGYWSLETWGGATFDACIRFLG
EDPWERLRELKKAMPNTPMQMLLRGQNLLGYRHYADDVVEKFVERAHANGMDVFRIFDAM
NDVRNFQKAVKAAVDVGAHAQGTLSYTTSPVHNTDTWVDLAKHLEDLGCHSLCIKDMSGL
LKPYEAEELITRIKASCDVPLALHCHATTGLSTATAVKAVEAGIDILDTAISSMSCTYGH
TPTETVVAMLQGTERDTNLKLDQIEPIAAYFREVRKKYAKWEGQLKGVDSRILIAQVPGG
MLTNMEGQLKEQGAADRIDEVLEEIPRVREDLGFIPLVTPTSQIVGSQAVINVLTGERYK
SITKETAGVLKGEYGAAPAPVNTALQAKVLDGKEAITCRPADLLEAEMENLTVDLMEKAQ
SEGIKLASERVDDVLTYALFPQVGLKFLKNRGNPDAFEPAPTLEAAKPAAQPVSGGVETY
SVRVDGQVYAVEVGPQGQLTSVTPNTATVPAQPAAPSAPANSAAEAVPAPLAGNIFKVNV
QPGAEVLEGDVLLILEAMKMETEVRAARGGVVQELNVKEGDAVTVGSPLLSLA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccactggctatcactgatgtggtccttcgtgacgcccatcaatccctgttt
gctacgcgtatgcgtatcgaagatatgctgcctatcgcagctgagttagataaggttggt
tactggtctttagagacctggggtggcgcaacatttgatgcgtgtatccgtttcttggga
gaagacccatgggagcgcctacgcgaattaaaaaaagcgatgccaaacacaccaatgcaa
atgctactacgtggtcaaaaccttttaggataccgtcattatgctgacgacgtagtagag
aagtttgttgagcgtgctcatgccaatggtatggacgtgttccgcatctttgatgcaatg
aatgacgtacgtaacttccaaaaggcggtaaaagcggcagtagatgtcggtgctcacgca
caaggtaccttgtcttacaccaccagtccggtgcataacacggatacttgggttgatctg
gctaaacaccttgaagatctgggttgccactctctgtgtattaaagacatgtctggccta
cttaagccgtacgaagcagaagagctgatcacgcgcatcaaagcatcttgtgatgtgcct
cttgcgcttcactgccatgcaaccacagggctttctacggcgactgcagtgaaagctgta
gaagcgggtatcgatattcttgatactgcgatttcgtctatgagttgtacatacggccat
acgcctactgagacagtggttgcgatgctgcaaggcacagagcgtgatactaatctgaaa
ctcgaccaaatcgagcctatcgcggcttacttccgtgaagtacgtaagaaatacgccaag
tgggaaggtcagctaaaaggtgtggattcacgcattttgatcgcccaagttccgggtggc
atgttgaccaacatggaaggtcagttaaaagagcaaggtgctgcggatcgtattgatgag
gtattggaagagatccctcgtgttcgtgaagatcttggttttatcccgctggtaacaccg
acgtctcagatcgttggtagtcaagcggtaatcaacgtgctgacaggtgagcgttataag
agcatcaccaaagaaaccgctggtgttttgaagggggaatacggtgcagcgcctgctcct
gttaatacagcacttcaagcgaaagtgttggatggtaaagaagctattacttgtcgtcct
gccgatttacttgaagcagaaatggaaaacctaacggttgatttaatggagaaagcgcaa
tctgaaggtattaagctcgcaagtgaacgtgttgatgatgtgcttacttacgcactgttc
cctcaagtaggcctgaaattcctgaaaaatcgtggtaatcctgatgccttcgaaccagcc
ccaacgctagaagccgcgaagcctgccgcacaacctgtatctggtggcgttgaaacatac
agcgtgcgtgttgatggccaagtgtatgcagtggaggtaggccctcaaggtcaattaact
tctgtgacgccaaatacagcaactgtacctgctcaacctgcagcgccgagcgcacctgca
aatagtgccgctgaagcagtgccagcccctcttgcgggcaacatctttaaagtgaatgtt
caaccgggtgctgaagttttggaaggtgacgttctccttatcttagaagcgatgaagatg
gaaactgaagttcgtgcagcacgtggtggggtagttcaagaactgaacgtgaaagaaggt
gatgccgttacggttggttcgccactgttgagtctagcataa

DBGET integrated database retrieval system