KEGG   Vibrio campbellii: M892_14870Help
Entry
M892_14870        CDS       T02837                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
vca  Vibrio campbellii
Brite
KEGG Orthology (KO) [BR:vca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vca03016]
    M892_14870
Enzymes [BR:vca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     M892_14870
Transfer RNA biogenesis [BR:vca03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    M892_14870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AGU95542
UniProt: A7N1Y1
Position
I:3209742..3210509
Genome map
AA seq 255 aa AA seqDB search
MSEQEISPSVDPVVLEIVYQDEYFVAVNKPAGMLVHRSWLDKHETQFVMQTLRDQIGQHV
FPLHRLDRPTSGVLVFALSSEVASQVMPMFAEHKMEKTYHAIVRGWIEEEGVLDYALKVE
LDKIADKFASQEKEAQEAVTAYKPLAKVEVPYSTGKFPTTRYCLMEMKPKTGRKHQLRRH
MAHLRHPIVGDTTHGDGKHNKLYRTEFDSHRLLLHASELRFVHPFTDEKIVMKANIDETW
QQLFTRFEWDESLVK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacaagaaatatcaccatctgttgaccccgttgtattagagatcgtttatcag
gacgagtactttgttgcggtgaacaaacctgcaggtatgttagtccatcgcagttggttg
gataagcatgagactcaattcgtgatgcaaacgctacgcgatcaaattggtcagcatgtt
ttcccattgcaccgtttggatcgtcctacttctggtgtgcttgtgtttgctttgtccagt
gaagtggcatcgcaagtcatgccaatgtttgcagagcataagatggagaagacctatcac
gcgatcgttcgtggctggatcgaagaagagggtgtgctagattacgctctgaaagttgaa
ctcgataagatcgccgataagtttgcttcgcaagagaaagaagcacaagaagcagtaacg
gcatacaaaccgctagcaaaagtggaagtaccttattcaacgggtaagttcccaaccacg
cgctactgtttgatggaaatgaagccaaagacagggcgtaagcaccagctgcgtcgtcat
atggctcacctgcgtcatcctattgttggtgatacaacacatggtgatggtaagcacaac
aagttgtatcgcacggaattcgactctcaccgactgttgctgcatgcatcagagctgcgc
tttgtgcatccgtttaccgacgaaaaaatcgtgatgaaagccaatatcgatgagacttgg
cagcagttgttcactcgatttgagtgggatgaatcgttggtaaaataa

DBGET integrated database retrieval system