KEGG   Vibrio campbellii: M892_17970Help
Entry
M892_17970        CDS       T02837                                 

Definition
(GenBank) beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
vca  Vibrio campbellii
Pathway
vca00460  Cyanoamino acid metabolism
vca00500  Starch and sucrose metabolism
vca01100  Metabolic pathways
vca01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M892_17970
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    M892_17970
Enzymes [BR:vca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     M892_17970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase GHL6
Motif
Other DBs
NCBI-ProteinID: AGU97027
UniProt: A7N5G4
Position
II:44859..46208
Genome map
AA seq 449 aa AA seqDB search
MNKFQLPQDSKLRSPEFLFGVATSSYQIEGGAQLGGRTPSIWDTFCNKPGAVDNADNGDV
ACDHFHLWKQDIEMIQGLGVGAYRLSMAWPRIIPEDGKVNEEGLKFYEQIIDECHARGLK
VFVTLYHWDLPQYLEDKGGWLNRETAYKFEEYAKVVSAYFGDKIDSYATLNEPFCSAYLG
YRWGEHAPGLKGEREGFLSAHHLMLAHGLAIPHMRKNAPNAMHGCVFNATPAYPYGEADI
GAAEYSDAEGYHWFMDPVLKGEYPQLVVKRQSHNMPMILEGDLDIIQTDLDFIGINFYTR
CVVRYNEHGDIETVPQPEQEHTFIGWEIHPQALTDLLLRLNDRYPNLPPLYITENGAAGD
DHCIEGEVNDEQRVRYFQQHLVALDAAIKAGVDVDGYFAWSLMDNFEWAYGYKQRFGIVH
VDYQTQKRTLKASAIAYRNMLLDRAEENQ
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattccaactaccacaagattcaaaattacgtagcccagagttcttatttggt
gtcgcaacctcttcttatcagattgagggtggtgctcagctaggtggtcgtacgccttcg
atttgggacacgttttgcaataagccaggcgcagttgataacgcagataatggcgacgtg
gcatgtgatcacttccatttgtggaagcaagacattgagatgattcaaggtttgggtgtg
ggcgcttaccgtctatcgatggcgtggccgcgcatcatccctgaagatggcaaagtgaat
gaagaaggtttgaagttttacgagcaaatcatcgatgagtgtcacgctcgcggtttgaag
gttttcgttacgctttaccattgggatctaccgcaatacctagaagacaaaggcggttgg
ctaaaccgagaaacggcttacaagtttgaggaatacgcgaaggtagttagtgcttacttc
ggtgataagattgattcatacgcgacattgaacgaaccgttctgctctgcttatctgggc
taccgttggggtgaacatgctcctggccttaaaggcgagcgtgaaggtttcttgtctgcg
caccacttgatgctggcacatggtttggcgattccacacatgcgcaagaacgcaccaaat
gcgatgcacggttgtgtgttcaatgcgacacctgcttacccatatggcgaggcagatatc
ggtgcggcagagtacagcgatgcggaaggttaccactggtttatggacccggtattaaaa
ggcgaatatccgcagcttgtggtaaagcgccaatcgcacaacatgccaatgattctagag
ggcgatctcgacatcatccagaccgatttggactttatcggcattaacttctacacccgt
tgtgttgtgcgctacaacgaacatggcgatattgaaacggtacctcaaccagaacaagag
cacacattcattggttgggaaattcacccgcaagcactgacagatttgcttctgcgtttg
aacgaccgttacccgaacttgccaccactttacatcacagaaaacggcgcagcaggcgat
gatcattgcattgaaggcgaagtgaatgatgagcagcgcgtgcgttacttccagcagcat
ctagtagcgttggatgccgcgattaaagcgggtgtggatgtggatggttacttcgcttgg
agcctcatggataactttgagtgggcttacggttataagcagcgctttggcattgttcac
gtggattaccaaacgcaaaagcgcaccttaaaagcgagcgcaattgcttaccgtaatatg
ctgctagaccgagcagaggagaaccagtaa

DBGET integrated database retrieval system