KEGG   Vibrio campbellii: M892_18910Help
Entry
M892_18910        CDS       T02837                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
vca  Vibrio campbellii
Pathway
vca00310  Lysine degradation
vca01100  Metabolic pathways
vca01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    M892_18910
Enzymes [BR:vca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     M892_18910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 FAD_binding_3 NAD_binding_8 NAD_binding_9 TrkA_N Trp_halogenase Pyr_redox_3 FAD_binding_2 Amino_oxidase Thi4
Motif
Other DBs
NCBI-ProteinID: AGU97130
UniProt: A7N6X7
Position
II:230737..231969
Genome map
AA seq 410 aa AA seqDB search
MKSAYDYIIVGGGIVGVSTAWQLQQRHPDKSILLVEKESGFAKHQTGHNSGVIHAGVYYA
PGSLKADFCKRGVERTISFCAEHDIPVENCGKLLVATNEQEVERMNALYERCHVNGIDVK
LLDEVQLKLAEPNITGLGAIYVKTTSIVDYRLVTEQMAEEFQKLGGQISLRTKVVAAEEK
DEEVQLTCTSDGQTMQLNAKFLVTCSGLMADRMTKMMGILTDFQIIPYRGEYYRLDSKHD
QVVNHLIYPIPDPDLPFLGVHLTRMIDGSVTVGPNAVQGWKREGYDKVNFSLQDTMQMLS
FSGFWKVTQKHLKTGLDEFKNSWWKPGYLKLVNKYCPSIKVEDLKPYPAGIRAQAVLSDG
TLVHDFLFAESARSLHVCNAPSPAATSAMPIGEYICDKVNEKIEAKTEAV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagcctatgactacatcattgttggtggcggtatcgttggtgtgtcgacagca
tggcaactgcagcaacgtcatccagacaaatccattttattggttgagaaagagtccggt
tttgccaagcaccaaaccggacataatagtggcgtgattcatgccggggtgtactacgca
ccgggcagcttaaaggcagatttttgtaagcgaggggtagagcgaaccatttcgttctgc
gccgagcacgatattccggtggagaactgtggcaagttactggttgctaccaatgagcaa
gaagtcgaacgtatgaatgccctctatgagcgctgccatgtcaacggcatcgacgtaaag
ctactcgatgaagttcaactcaagctggctgagccaaacatcacaggcttgggcgcgatt
tatgtcaaaaccaccagtattgtcgattatcgtttggtcactgagcagatggcggaagag
ttccaaaagctcggtggtcaaatcagcctgagaaccaaagtagtggctgccgaagagaag
gatgaagaagtccaactgacctgcacttcagacggtcaaaccatgcagctcaatgccaaa
ttcttggtcacttgcagtggcttgatggcggatcgcatgactaagatgatgggtattcta
accgatttccaaatcatcccttatcgcggcgaatactaccgtttggatagtaagcacgac
caagtcgtgaatcatcttatttacccaatcccagatcctgatttgccttttttgggtgtc
cacctcactcgtatgattgatggtagtgtgaccgttggtccaaatgcggtgcaaggctgg
aagcgagaagggtacgataaggtcaactttagcctgcaagataccatgcaaatgctcagc
ttttcaggtttctggaaggtgacacaaaagcatctaaaaaccggattggatgagtttaag
aactcgtggtggaagccgggctatctcaagctggtcaataaatactgcccaagcatcaag
gtggaagatctcaaaccatatcctgcgggtattcgtgcgcaagcggtgttgtccgatggc
actttggttcatgacttcctgtttgccgagagcgcaagaagcctacacgtttgcaacgca
ccctctcccgcagcgacatctgcaatgccgattggggagtacatttgcgataaagtgaat
gagaagatagaggcaaaaaccgaggcggtttaa

DBGET integrated database retrieval system