KEGG   Vibrio campbellii: M892_20825Help
Entry
M892_20825        CDS       T02837                                 

Definition
(GenBank) fatty acid reductase LuxC
  KO
K03400  long-chain-fatty-acyl-CoA reductase [EC:1.2.1.50]
Organism
vca  Vibrio campbellii
Pathway
vca02020  Two-component system
vca02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M892_20825
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    M892_20825
Enzymes [BR:vca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.50  long-chain acyl-protein thioester reductase
     M892_20825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LuxC Aldedh
Motif
Other DBs
NCBI-ProteinID: AGU98399
Position
II:649425..650786
Genome map
AA seq 453 aa AA seqDB search
MKEKKVKIDSFNHVHLTQMVTHDYLNDININNIINFLYTTGQRWKSEEYSRRRAYIRSLV
TYLGYSPQMAKLEANWIAMILCSKSALYDIIDTELGSTHIQDEWLPQGECYVRAFPKGRT
MHLLAGNVPLSGVTSILRGILTRNQCIVRMSASDPFTAHALAMSFIDVDPNHPISRSISV
LYWPHASDTTLAEELLNHMDAVVAWGGRDAIDWAVKHSPSHIDVLKFGPKKSFTVLDHPA
DLEEAASGVAHDICFYDQNACFSTQNIYFSGDNYEEFKSKLVEKLNLYQEVLPKSKQNFD
DEALFSMTRLECQFSGLKVISEPENNWMIIDSEPGVEYNHPLSRCVYVHKINKVDDVVQY
IEKHQTQTISFYPWESSKKYRDAFAAKGVERIVESGMNNIFRVGGAHDAMRPLQRLVRFV
SHERPYHFTTKDVSVEIEQTRFLEEDKFLVFVP
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaaaaaaaagttaagattgattcctttaatcatgttcatttaactcagatggtg
actcatgattatttaaatgatataaatataaataacatcatcaattttctttatacaaca
gggcagcgttggaagagcgaagagtattcaagaagaagggcatatattcggtctcttgtt
acttatttggggtattcaccacaaatggcgaaactcgaagcaaattggattgcaatgatc
ctttgctctaagagtgcgctctacgacattattgataccgaacttggctctacgcatata
caagatgaatggttaccgcagggtgagtgttatgtgagggcttttcctaaaggacgcacg
atgcatttgcttgcggggaatgttcctctctccggtgtgacctcaatactacgaggcata
ctgacgagaaaccaatgtattgtgagaatgtcagcatcggatccatttactgcccatgcg
ctagcgatgagctttattgacgtcgatcccaaccatcctatttctcgttctatttccgta
ttgtattggcctcatgcatcggatacgacactcgctgaagagttactcaatcatatggat
gcagtggttgcttggggggggcgagatgccattgattgggcggttaagcattctccttca
cacatcgatgttttgaagtttggtccaaagaagagttttaccgtgttagaccatccagcc
gatctagaagaagccgcctcgggtgttgctcatgatatttgcttttatgaccaaaatgcc
tgcttttctactcagaatatttacttttctggagataattatgaagaatttaaatcgaaa
cttgttgaaaaactgaatctttatcaagaagttttaccaaaatcaaagcaaaattttgat
gatgaagctttattttctatgactcgtcttgagtgtcaattttctgggttgaaagtgata
tcagaaccggaaaataactggatgatcatcgattcagaaccgggggttgaatataaccat
ccattaagtcgctgcgtttatgtccacaaaataaataaagttgatgatgttgttcaatat
atagagaaacatcaaacacaaacgatttctttttatccatgggagtcttccaagaaatat
cgagatgcattcgccgcaaaaggagtagaaagaatcgttgaatctggaatgaataacata
tttagagtcggtggtgcacatgatgccatgcgaccacttcaacgtttagttcgatttgtt
tctcatgaaagaccatatcacttcaccactaaggatgtatctgtcgaaatagagcaaacc
cgctttctcgaagaagataaattcttggttttcgtcccttaa

DBGET integrated database retrieval system