KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I0901Help
Entry
Vch1786_I0901     CDS       T01650                                 

Definition
(GenBank) two-component system, chemotaxis family, response regulator CheB
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce02020  Two-component system
vce02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vce00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Vch1786_I0901
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Vch1786_I0901
Enzymes [BR:vce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Vch1786_I0901
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Vch1786_I0901
Two-component system [BR:vce02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Vch1786_I0901
Bacterial motility proteins [BR:vce02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Vch1786_I0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg z-alpha
Motif
Other DBs
NCBI-ProteinID: AET26505
Position
1:complement(968205..969281)
Genome map
AA seq 358 aa AA seqDB search
MKILVVDDSALMRTTISDILQNIPNAEIKTARDGMDAIDKVMKWQPDVMTLDINMPNMDG
LTCLTQIMVERPLPIVMLSSLTHEGAITTLEALYLGAVDFVAKPGGTICGRLQEVAPLIR
EKVRAAAKMRVKVHTQLSVSPAEVEHKHKSPVVENNEDHQLAIMGVSTGGPGTVETILRH
LPADFSLPIIVNQHMPESFTAAFAQRLNRHLQQPVKEINRALVLEAGTVYVCKGDRDCIV
TLRDGKLAAMPTPNDSHFSWHPSVSKLVASAIRTCGEDNLLCVMLTGMGDDGATEMAQVA
QGNGIVFAQEPTTCVVPSMPEALLKRVPHIPTGTPEHLAYLMTEVVRQSSRELHYGNH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttagttgtcgatgattctgcgttaatgcgcaccaccattagcgacatattg
caaaacattccgaatgccgagattaaaacagcacgtgatggtatggatgccatcgacaaa
gtgatgaaatggcaaccggatgtgatgacgttagacatcaatatgcccaacatggatggt
ctaacttgccttacgcaaatcatggttgaacgtcccttgccgattgtcatgctctcatcc
ctcacccatgaaggtgccattacaacgctcgaagcgctttatcttggtgcggtagacttt
gtcgccaaacccggaggcactatctgcggtcgattacaagaagtcgcaccactgatccgt
gaaaaagttcgcgcggcagcgaaaatgagagtcaaagttcacacgcagctttcggtatca
ccagcagaagtagagcacaaacataagtcacctgtggtggaaaataatgaagaccaccag
cttgcgatcatgggggtttcgacaggagggcccggcactgttgaaacgatactgcgccat
ctgcccgccgatttctcattacctattattgttaaccaacacatgccagagagcttcact
gccgcctttgcacaaaggcttaatcgccatctgcaacaacccgtgaaagagattaaccgt
gctttagtgcttgaggctggtaccgtttatgtttgcaagggtgaccgagactgcattgtc
acgctacgtgatggtaaattggctgccatgcccacgccaaatgatagccatttttcatgg
catcccagcgtctccaaactggttgccagcgccatacgcacttgtggagaagataactta
ttgtgcgtcatgctaacgggaatgggcgacgacggtgccactgaaatggctcaggttgct
caaggaaacggtattgtttttgcccaagaacccacaacctgcgtagtccccagtatgccg
gaagcattacttaaacgtgtaccccatattccaacaggaactccagagcacttagcttat
ctgatgaccgaagtggtgagacagtccagtagggagcttcactatggcaatcattaa

DBGET integrated database retrieval system