KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I1766Help
Entry
Vch1786_I1766     CDS       T01650                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce00330  Arginine and proline metabolism
vce00332  Carbapenem biosynthesis
vce01100  Metabolic pathways
vce01130  Biosynthesis of antibiotics
vce01230  Biosynthesis of amino acids
Module
vce_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:vce00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Vch1786_I1766 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Vch1786_I1766 (proB)
Enzymes [BR:vce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Vch1786_I1766 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AET27358
Position
1:complement(1898417..1899550)
Genome map
AA seq 377 aa AA seqDB search
MTTNQRSIKAPQTVVVKLGTSVLTGGTLALDRAHMVELARQCAELKKQGHSVVIVTSGAI
AAGREHLGYPALPNAISSKQLLAAVGQSRLIQVWESLFAIYGIKIGQMLLTRADLDDRER
FLNARDTINALVENGIVPVVNENDAVATNEIKVGDNDNLSALVGILCGADKLLLLTDQKG
LFTADPRKDPNAQLIKEVTTIDDTLRKIAGGSGTTLGTGGMATKLQAADIARRAGIEVII
AAGRAPNVIFDSLSDEPQGTRFLALEEALENRKRWILAGPAASGDIVIDDGAVKAVQTKG
SSLLAKGVVRVQGQFARGEVVRVLDKQSHLIARGIAAYSNDELAQIAGKHSKEIIDILGY
DHGSEVIHRDDMVVIQE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaaatcaacgaagcatcaaagctccacaaacggttgttgtgaagctgggaacc
agtgttctgaccggcggtactcttgcgctggatcgtgctcatatggttgagctcgctcgc
cagtgtgctgaactcaaaaagcaaggtcactcagtagtgatcgtgacctcgggcgccatt
gcggctggccgtgagcatttaggttaccctgcgctgcccaacgcgatttccagcaagcaa
ctgctggcagcggttgggcaaagtcgtttgattcaggtctgggaatcgttatttgcgatt
tatggcatcaaaattggtcagatgctgctcacccgtgctgatcttgatgaccgtgagcgt
ttccttaatgcgcgtgacaccatcaatgcgttagttgaaaatggcattgtgcctgtggtc
aacgaaaacgatgcggtagcaaccaatgaaatcaaagtcggtgacaacgataacttatcg
gcgctggtcggtattttgtgtggtgcggataagctgctgctgttgaccgatcaaaaaggc
ttgttcaccgccgatccgcgtaaagatcccaatgcccaactgatcaaagaagtgaccacc
attgatgacacactgcgcaaaattgctggtggcagtggcactacactcggtacgggcggc
atggccaccaagctgcaagcggcggacattgctcgtcgtgctggtattgaagtcatcatt
gcggcaggtcgtgcgcccaatgtgatttttgactccttaagtgatgagccacaaggcacg
cgcttcttagctttggaagaagcgttagaaaaccgcaaacgctggattttggcaggccca
gcggcatcaggcgatattgtgattgacgatggcgcagtgaaagcggtgcaaaccaagggc
agcagcttgctcgccaaaggtgtggtgcgagtgcaaggtcagttcgcccgtggtgaagtg
gtgcgggtactggataagcaaagtcatctgattgcgcgcggcatcgcggcctactccaat
gacgagttggcgcaaattgctggtaagcacagtaaagagatcatcgatattttaggctac
gatcacggctcagaagtgatccaccgcgacgacatggtcgtgattcaagagtaa

DBGET integrated database retrieval system