KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I2391Help
Entry
Vch1786_I2391     CDS       T01650                                 

Gene name
glyQ
Definition
(GenBank) glycyl-tRNA synthetase subunit alpha
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:vce00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Vch1786_I2391 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vce01007]
    Vch1786_I2391 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vce03016]
    Vch1786_I2391 (glyQ)
Enzymes [BR:vce01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Vch1786_I2391 (glyQ)
Amino acid related enzymes [BR:vce01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Vch1786_I2391 (glyQ)
Transfer RNA biogenesis [BR:vce03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Vch1786_I2391 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: AET27964
Position
1:2534266..2535258
Genome map
AA seq 330 aa AA seqDB search
MSGNIWVYFSVIFYQFRQKNRANLTMQKYDIKTFQGMILALQDYWAQQGCTIVQPLDMEV
GAGTSHPMTCLRALGPEPIATAYVQPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQ
ELYLGSLRVLGVDPCVHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLE
CKPVTGEITYGIERLAMYIQGVDSVYDLVWTDGPLGKVTYGDIFHQNEVEQSTYNFEHAD
VDFLFTYFDQCEKECKYLLELEKPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILR
IRNLTKSVAEAYYASREALGFPMCKKSEQK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagggaatatctgggtatacttcagtgttattttttatcaattcagacagaagaat
cgcgcgaacctgactatgcaaaaatacgacatcaaaacctttcagggtatgatcctcgcg
ctgcaggattattgggcccaacaaggctgtactattgtgcaacctctcgacatggaagtg
ggtgcaggtacttctcacccgatgacttgcttacgagcattaggccctgaacctatcgca
accgcgtacgttcaaccctcacgccgcccaactgacggccgctacggtgaaaacccaaac
cgtctgcagcactactaccagttccaggtgatcatcaaaccctcaccagacaacatccaa
gagctgtacctaggttcactgcgtgtactgggtgttgacccttgtgtgcatgacatccgc
tttgtggaagacaactgggaaaacccaaccttaggtgcttggggtcttggctgggaagtg
tggctaaacggcatggaagtgactcagttcacttacttccagcaagttggcggtcttgag
tgtaagcctgtgaccggcgaaatcacttacggtattgagcgtctggcaatgtacattcag
ggcgtggattcggtttacgatctggtctggaccgatggcccactgggcaaagtgacttac
ggcgacatcttccaccaaaacgaagttgaacaatccacttacaactttgaacacgcggat
gtggatttcctcttcacttacttcgaccagtgtgaaaaagagtgtaaatacctgctagag
cttgaaaagccactgcctctgccagcctacgagcgtattttgaaagcggcacacgccttc
aacttgctcgatgcacgcaaagcgatctcagtgactgagcgtcagcgctacattctgcgc
attcgcaacctaaccaaatcggtcgccgaagcttattacgcatcccgtgaagctctgggc
ttccctatgtgtaagaagtcagaacagaagtaa

DBGET integrated database retrieval system