KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0031
Entry
Vch1786_II0031    CDS       T01650                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vce  Vibrio cholerae O1 2010EL-1786
SSDB
Other DBs
NCBI-ProteinID: AET28453
Position
2:31645..32316
AA seq 223 aa
MTDTVSSTPVADTTPYEIFLSGNDDFLIPVVFPDYLISVADEQSFELWGVKIKTPAVKAP
YLGHAGVILINGETGVTRYYEYGRYKNPKSDIPGNVRKVGVSNVTIKSGLITESSLLKVL
KEVSLRSGQEGRISGVVLRGKFFSEADSWLRGKMDLNNSPDKIPYDLDSHNCMTFVIDLA
DAMGLDPAWKPPVVVPSAYIEQFQLSEIDLDYDYKTNKLTVSE
NT seq 672 nt   +upstreamnt  +downstreamnt
atgactgacactgtatcatcaactccagtagccgatacaactccatatgagatatttctt
tcaggtaatgacgattttttgatacctgtagtatttcctgactacctaatctcagtcgca
gatgaacaatcttttgagttatggggtgtaaaaataaaaactcctgcagtgaaggccccc
taccttggtcacgctggagttattttgattaatggtgaaacaggtgttactcgctattat
gagtatggccgttacaagaaccctaaatcggatatcccaggaaatgtgaggaaggttggg
gtatcaaatgtaactataaaaagtggtctaattactgaaagctcgttactgaaggttctt
aaagaagtgtccctacgttctggacaggaggggagaatttcgggagtggtattaagagga
aagtttttctctgaagcagattcatggttaaggggaaaaatggatcttaataatagccct
gataagataccttatgacttggatagccataactgcatgacatttgtcatagatttagct
gatgcaatggggttagacccggcttggaaacctcctgttgttgtaccaagcgcgtatatt
gaacagtttcagttaagtgaaattgatttagattatgactataagaccaacaaattaacg
gtatctgagtga

DBGET integrated database retrieval system