KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0374Help
Entry
Vch1786_II0374    CDS       T01650                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce00071  Fatty acid degradation
vce00280  Valine, leucine and isoleucine degradation
vce00310  Lysine degradation
vce00362  Benzoate degradation
vce00380  Tryptophan metabolism
vce00620  Pyruvate metabolism
vce00630  Glyoxylate and dicarboxylate metabolism
vce00640  Propanoate metabolism
vce00650  Butanoate metabolism
vce00900  Terpenoid backbone biosynthesis
vce01100  Metabolic pathways
vce01110  Biosynthesis of secondary metabolites
vce01120  Microbial metabolism in diverse environments
vce01130  Biosynthesis of antibiotics
vce01200  Carbon metabolism
vce01212  Fatty acid metabolism
vce02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Vch1786_II0374
   00630 Glyoxylate and dicarboxylate metabolism
    Vch1786_II0374
   00640 Propanoate metabolism
    Vch1786_II0374
   00650 Butanoate metabolism
    Vch1786_II0374
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Vch1786_II0374
   00072 Synthesis and degradation of ketone bodies
    Vch1786_II0374
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Vch1786_II0374
   00310 Lysine degradation
    Vch1786_II0374
   00380 Tryptophan metabolism
    Vch1786_II0374
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Vch1786_II0374
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Vch1786_II0374
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Vch1786_II0374
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vce04147]
    Vch1786_II0374
Enzymes [BR:vce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Vch1786_II0374
Exosome [BR:vce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Vch1786_II0374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AET28795
Position
2:complement(328643..329848)
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKECSAGALAGQVIQAALEAAQLKPEAVDEVIVGNVVSAG
QGMGVGRQAALAAGVPQSVPAYSINMVCGSGMKSVMDAVAHIKAGDASVVVAAGVEVMSQ
IPFVTPASLRDGQKMGAFEVKDLLIHDGLTDVFNQYHMGVTAENIAKQYDIARQTQDEFA
LASQMKATAAIEAGHFKREIVPISVKKRRETVVFDTDEYPKPTTTLAALQGLRAAFDAQG
TVTAGNASGINDGASAVIIASESAVKKLGLTPIAEIMSYAQTGLDPKVMGLGPVSAVTQA
LAKAELSITQVDLFELNEAFAAQALGVVYGLAEQHAIQPEAILEKANVNGGAIALGHPLG
ASGNRILVTLLHELQRRQKHYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatctatatcgtgggcgcaaagcgctcagctatcggagcctttggtggttca
cttaaagagtgttcagcaggcgctttggcagggcaagtcatccaagccgctcttgaagcc
gcacaactcaaacctgaagctgtggatgaagtgattgttggtaacgttgtgagtgccgga
caaggcatgggtgttgggcgtcaagcggctttagcggctggtgttccacagtcggttcca
gcttacagcatcaacatggtgtgtggcagtgggatgaaatcggtgatggatgcggttgcg
cacatcaaagcgggagatgcttctgtcgttgttgccgctggtgttgaggtcatgtcacaa
atcccatttgttacgcctgccagcttacgagatgggcagaaaatgggcgcgtttgaagtg
aaagatctgctcatccatgacggtctgaccgatgtcttcaatcaataccacatgggtgtg
acggcagaaaatatcgctaaacagtacgacatcgctcgtcaaacacaagatgagtttgcg
ttggccagccaaatgaaagcgacagcggccattgaagccggacattttaagcgagaaatt
gtgcctatttcggtcaaaaaacgccgtgaaaccgtcgtgtttgatacggatgaataccct
aaaccgacgaccacgttggcagcattgcaaggcttacgcgccgcgttcgatgcacaaggt
acggttaccgcaggtaatgcttctggaattaacgatggtgccagtgcggtgattatcgcc
agtgaaagtgcggtaaaaaaactaggcttaacccctatcgcagaaattatgagttatgca
caaacagggttggatccgaaagtcatgggcttagggcctgtgagtgcagtcactcaagca
ttagcgaaagcagaattatctatcactcaggttgatctgtttgaacttaacgaagcgttt
gccgctcaagcattaggtgtcgtttacggtttagctgagcaacacgcgattcaacctgag
gcgattttagaaaaagccaacgtcaatggcggtgccattgcgttagggcatccattaggg
gcatcgggtaaccgcattctggttactctgcttcatgaattacagcgtcgccaaaaacat
tatggcgttgcttcactctgcgtcggcggtggcatgggtaccgcgatcgtgattaaaaca
gtttaa

DBGET integrated database retrieval system