KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0518Help
Entry
Vch1786_II0518    CDS       T01650                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce00360  Phenylalanine metabolism
vce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vce00790  Folate biosynthesis
vce01100  Metabolic pathways
vce01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Vch1786_II0518 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vch1786_II0518 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Vch1786_II0518 (phhA)
Enzymes [BR:vce01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Vch1786_II0518 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AET28936
Position
2:complement(473285..474079)
Genome map
AA seq 264 aa AA seqDB search
MTQYHSKPVSEHGHIDWDQDEHAVWHELITRQQEVVKTRACQAYLDGLNMLNLPTDRLPQ
LPEINRVLQRETGWQVEPVPALISFDRFFALLADKKFPVATFLRRREEFDYLQEPDFFHE
VYGHCAMLTHPDFAAFTHVYGQLGAKATPKERSYLARLYWFTVEFGLVQEQGQTKIYGGG
ILSSPGETLYASESTIPKREPFDIMQVLRTPYRIDIMQPIYYVLPDLSQLYQLSQRDVMA
LVWQAMQDGLLPPLFQPKEQQHAG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgactcagtatcactctaaacccgttagtgagcatggtcatattgattgggatcaggat
gagcatgctgtttggcatgagctgatcactcgccagcaagaagtggtgaaaaccagagcc
tgccaagcttatttagatggtttgaatatgcttaatttgccgacagatcgcctgccacaa
ttgccggaaataaaccgagtattgcaaagagaaaccggttggcaagttgagcctgttccg
gcattgatcagttttgatcgcttctttgccttactcgccgataagaagtttccagtggcc
acgtttttgcggcgtagagaggagtttgattatctccaagagccggatttcttccatgaa
gtgtatggtcactgcgctatgctcacgcaccctgattttgccgcttttactcatgtttat
ggccagctaggtgctaaagccacccccaaagagcgtagctacttagcgcgtctgtactgg
tttacggttgagttcggtttagttcaagaacagggacaaaccaaaatttatggcgggggc
attttgtcgtcaccgggtgaaacgctttacgcttcagaaagcacaatcccaaaacgtgag
ccgttcgatattatgcaagtgctacgcactccttaccgcattgatatcatgcagccgatt
tattatgtgttgccggatctcagtcaactgtatcaactcagtcaacgcgatgtaatggcg
ttggtgtggcaagctatgcaagacgggttactcccgcctctttttcaaccaaaggaacaa
caacatgctggatga

DBGET integrated database retrieval system