KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0816
Entry
Vch1786_II0816    CDS       T01650                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vce  Vibrio cholerae O1 2010EL-1786
SSDB
Other DBs
NCBI-ProteinID: AET29234
Position
2:796228..799485
AA seq 1085 aa
MSNPNQAAKTGQTNDAQNPASACPFKQPLIGIIPVRYAFDVYDDQGQALHPLPKADRQWK
GQFSIKQRSYTLRQLRDGWLYVYDETAKTLHEYEVVGCKLTKIDWSDDEANKPTHERGSK
GESKSCLLYPAQHTLSIGYAHQRWTWRVCEHMRSNTSSRHAVMRKVSLKQFESNGTHPHA
HFAQYLEDYVADIGTPAEQDIFKDTCTPSLPVEKSEEAVKGTEFKFVADKAVVSSSDYLQ
DLPEQNCGLFVALNDPLADVSDLFVTFTTQVAKRTKAIGDETQQHKMQMAELTRTLGRIR
LEEKEIPDFVKQDPIRILELERAITEYCATAKLAEIESHHLASEGHSPSGNYALMQQQAE
QKLAELKTLYRFEPTSAQMRKWRKKDNSFIDEVRWADLDNFLVEHYTELKGLDEQIKQHY
AQFMSAFNQLGLDPLLFGMDNQDEVQQAYLLALTSQFLVVVTQVNHDEKSLEILKKDLSF
DSPKNLMALASTGFSLQANQAINNHIQGFSTAFLSTSNPSDMVAFATAIANWDTFTGDER
IQEKAWFKRWIEPAQSSFGALQKAVANQAKESWQAVMELLFPYQNQPKGGTPSLLANLRL
LLVESLVREEAVLQHNPKYAAELKQFETKLNAILQEMNDALELKPGNVSPKNHQIATAQS
AQRKLGQLLSSELPMMLTLKNQAAMNTFQQSVNEKLSALSKNVKTSSASVSQKLGGLGGL
LFALNLWNTMTVLENIRYKVAQYPSWNPFKNPALGEAIYATGNTIVVAGAISAGRAWVTI
AEQGLLDRTLKNALNTTKVLGTKDALKTFAKSIALVATVGMIASALETWESWGKFNDSSK
TDLERFGYLLKAGATGAQGIIFYIQFFTLLGSGIGGPSIAAISAGWMLAGFAVIGIVYLI
GVILTNVFKRSELEIWLSKSTWGKESAHWPVGKELTELEHLLHRPSLRLSQVTQRKAAQW
MDSGSLQWQLELTLPDYLKGQTIGLQITRLPAQPAYYQPQREAVTPILINEQQGKWSIED
NQPVYRITLGGSEKDTVGVCVALPLRWGKELSLKFYASGTRAGELDLQSAEANDIATRNL
VVGKG
NT seq 3258 nt   +upstreamnt  +downstreamnt
atgagtaatcccaatcaagctgcgaaaacaggacagaccaatgatgcgcaaaatcccgcc
agtgcatgtccttttaaacagccgttaatagggataattcctgttcgttacgcctttgat
gtttatgatgatcaaggtcaagcattacatcctttacccaaagcggatcgacagtggaaa
ggtcaattctctatcaagcagcgcagttacactttaaggcaactgcgtgatggctggctc
tatgtctatgatgaaacagcaaaaacactgcacgaatatgaagtcgttggctgcaagttg
accaaaattgattggtctgatgatgaggcaaacaaacccactcacgagcgcggttcgaaa
ggtgaaagcaaaagctgtttactctatcccgcccagcacacgctctctatcggttatgcg
catcaacgatggacgtggcgagtgtgtgagcatatgcgctccaataccagcagccgtcat
gctgtgatgcgtaaagtgagccttaaacagtttgagtccaatggtactcaccctcatgca
cattttgctcagtatcttgaagactatgtggcggacatcgggacgccagctgagcaggat
atttttaaagatacctgtaccccttcattaccggtagagaaaagtgaagaagcggtgaaa
ggtacggaattcaaattcgttgccgacaaagcggtggtaagcagcagtgattatttgcaa
gatttgccggagcaaaactgcggtttatttgtggcgctgaatgaccctttagcggatgtg
tcagatttatttgttacttttactacccaagtggcaaagcgaactaaagcgattggtgat
gaaacgcaacagcataaaatgcagatggcagagctgacacgcacattaggccgaattcgt
cttgaagaaaaagaaattcccgattttgtaaaacaagatccgatccgtattttagagcta
gaaagagccattactgaatattgtgctacggcaaaattggccgaaatcgaatctcatcat
ttagccagtgaagggcattccccatcgggaaactatgccttgatgcagcagcaagcggag
cagaaactggcggaattgaaaacactctatcgctttgaacccaccagtgctcagatgcgc
aagtggcgcaaaaaagacaacagctttattgatgaagtgcgttgggcggatttagataac
tttttggtggagcattacaccgagctcaaaggattggatgaacagattaaacaacactat
gcgcagtttatgtctgccttcaaccagctcggccttgacccgcttctgtttggtatggat
aaccaagatgaggttcagcaagcgtatttgttagcattaactagccaatttttagtggtg
gttacgcaagtcaatcatgatgaaaaatcgcttgagatcctaaaaaaagatctcagtttt
gattcaccgaaaaacctcatggccctcgcgtcaacaggcttttccctgcaggcaaatcaa
gccattaacaaccatatccaagggtttagcaccgcttttctctctacaagtaatcctagt
gatatggtggcgtttgcgaccgcaatcgctaactgggatacgttcacgggggatgaacgt
attcaggagaaagcatggtttaagagatggattgaacccgctcaatcgagttttggtgca
ctgcaaaaagcggtcgccaatcaagccaaagagagttggcaagcggtgatggagttgctg
tttccttatcagaatcagcccaaaggagggacgcccagtttgttggctaaccttcgttta
ctgttggtggaaagcctagttcgagaagaggcggtgctgcaacataaccccaagtatgcg
gctgagcttaagcaatttgagactaagctgaatgccattttgcaagagatgaatgatgct
ctggaactcaaacccggtaatgtgagcccgaaaaaccatcaaattgcgaccgcgcaatcc
gcacaacgtaagctagggcaattactcagtagtgagctgccgatgatgctgacgctcaaa
aaccaagctgcgatgaacacttttcagcagtcggtaaatgagaaactgagcgcgctatcg
aaaaacgtcaaaaccagtagcgcgtcggtgagtcagaaactgggtggattagggggcttg
ctgtttgcgttgaacctatggaataccatgacggttttggagaatatccgctataaggtc
gcacaataccccagttggaatccttttaagaacccggcgttgggcgaagccatttatgcc
actggcaacactattgtagtcgccggtgccattagtgctgggcgagcttgggtgacgatt
gctgagcaagggttgttagatcgtacactgaaaaacgccttaaataccacgaaagttttg
ggcacaaaagatgccctaaaaacctttgctaaatcgatcgccttggtggctaccgtgggc
atgattgccagcgcattagaaacatgggaaagctggggtaagtttaatgacagcagtaaa
accgatcttgaacgcttcggttatttgttaaaagctggagcaacgggagcacagggaatt
attttttatattcagtttttcacactcttaggtagtggaattggtggaccctccatagct
gcgatttctgcaggttggatgctcgccggttttgctgtgattggtattgtctatttgatc
ggggtgattttgaccaatgtgtttaaacgctcagagttagaaatttggttatcaaaatcg
acgtgggggaaagagagtgctcattggccagtgggcaaagaattgaccgagttagagcac
cttctccatcgtccgagtcttcggttgagtcaagttacgcaacgtaaagcagcgcaatgg
atggattcaggttctttacaatggcagttggaactcacgttacccgattatcttaagggg
cagacgataggcttacaaatcacccgtttgccagcgcagccggcatattatcaaccgcaa
agggaggcggtaacaccaatactcatcaatgaacaacagggcaaatggagtattgaagat
aatcagccagtgtatcgtattacactgggtggcagtgagaaggatactgtcggagtttgc
gttgcactgcccctgcgttggggcaaggagctgagcctcaaattctatgccagtggaact
cgcgcgggggaattggatttacaatctgcagaggcgaatgatattgccacaagaaatctc
gttgtaggaaaaggttaa

DBGET integrated database retrieval system