KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0902
Entry
Vch1786_II0902    CDS       T01650                                 

Definition
(GenBank) type VI secretion system protein ImpC
  KO
K11900  type VI secretion system protein ImpC
Organism
vce  Vibrio cholerae O1 2010EL-1786
Brite
KEGG Orthology (KO) [BR:vce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vce02044]
    Vch1786_II0902
Secretion system [BR:vce02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Vch1786_II0902
SSDB
Motif
Pfam: VipB VipB_2 DMP12
Other DBs
NCBI-ProteinID: AET29320
Structure
PDB: 
5MXN 5MYU

Position
2:890225..891703
AA seq 492 aa
MMSTTEKVLERPQLAQGSLLDEIMAQTRIAPSEEGYDIAKKGVAAFIENLMGSQHSAEPV
NKSLVDQMLVELDKKISAQMDEILHNSQFQAMESAWRGLKLFVDRTDFRENNKVEILHVT
KDELLEDFEFAPETAQSGLYKHVYSAGYGQFGGEPVGAIIGNYAFTPSTPDMKLLQYMGA
LGAMAHAPFISSVGPEFFGIDSFEELPNIKDLKSTFESPKYTKWRSLRESEDARYLGLTA
PRFLLRVPYDPIENPVKSFNYAENVSASHEHYLWGNTAFAFATRLTDSFAKYRWCPNIIG
PQSGGAVEDLPVHVFESMGALQSKIPTEVLITDRKEFELAEEGFIALTMRKGSDNAAFFS
ANSIQKPKVFPNTKEGKEAETNYKLGTQLPYMMIINRLAHYVKVLQREQIGAWKERQDLE
RELNSWIKQYVADQENPPADVRSRRPLRAARIEVMDVEGNPGWYQVSLSVRPHFKYMGAN
FELSLVGRLDQA
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgatgtctacgactgaaaaggtattggaaaggccacagcttgctcaaggcagccttctt
gatgaaattatggcgcaaacccgtatcgcaccaagcgaagagggttacgacatcgcgaaa
aaaggtgttgcagcgtttatcgaaaatcttatgggttcacaacactctgctgagcctgtc
aacaaatctctggttgaccaaatgttggttgaactggataaaaaaatcagtgcacagatg
gatgaaatcctgcacaactcacaattccaagcgatggaatcggcgtggcgcggtttgaag
ctgttcgtggatcgcactgattttcgtgaaaataacaaagtcgaaatccttcacgtaacc
aaagatgaactgctggaagatttcgagtttgctccagaaacggctcagtccggtctttac
aagcacgtttattctgccggttatggtcaatttggtggcgaacctgttggcgcgatcatt
ggtaactatgcgtttaccccttcaacgccagatatgaagctgctgcaatacatgggcgca
ctgggtgccatggcgcatgctcctttcatttcaagcgtaggtcctgaattctttggtatc
gactccttcgaagaactgcctaacattaaagatctcaagtcgacatttgaaagcccgaaa
tacaccaaatggcgttcactgcgtgaatcggaagatgctcgctatcttggtttgactgcg
cctcgtttcctgctgcgtgttccttacgatccaatcgaaaatccagtgaagtcgttcaat
tatgcggaaaacgtcagtgcttcgcacgagcactacctgtggggtaacacggcatttgcc
ttcgcaactcgtttgacggatagctttgctaaatatcgctggtgtccaaacattatcggt
ccacaaagtggtggtgcagttgaagatctgccggtgcatgtctttgaatctatgggtgca
ttgcaaagcaagatcccaaccgaagtcctgatcacggaccgtaaagaatttgaactggcg
gaagaaggttttattgctcttactatgcgtaaaggcagtgataacgcggcgttcttctct
gcaaactccattcaaaaacctaaggttttcccaaataccaaagaaggcaaagaagcggaa
accaactacaagttgggtacccagttgccgtacatgatgatcatcaaccgtttggcgcac
tatgtgaaagttctgcaacgtgagcagatcggtgcttggaaagagcgtcaagatcttgag
cgtgaactgaactcatggatcaaacaatacgttgctgatcaagagaacccacctgcagac
gtacgtagccgtcgtccacttcgtgctgcgcgcattgaagtgatggatgtggaaggcaat
ccaggttggtatcaggtgtcgctctcggttcgtcctcactttaagtacatgggtgcgaac
tttgagttgtcattagttggacgtcttgatcaagcctga

DBGET integrated database retrieval system