KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0903
Entry
Vch1786_II0903    CDS       T01650                                 

Definition
(GenBank) type VI secretion system protein
  KO
K11905  type VI secretion system protein
Organism
vce  Vibrio cholerae O1 2010EL-1786
Brite
KEGG Orthology (KO) [BR:vce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vce02044]
    Vch1786_II0903
Secretion system [BR:vce02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Vch1786_II0903
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AET29321
Position
2:891706..892143
AA seq 145 aa
MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAP
HLGLVDFNDATLETLDLSVRIKLAIQQCLERYEPRLTRVLVRADQDSFNPLTLRFHITAT
INSEALHEKVQFSLLLDQSRKYRVF
NT seq 438 nt   +upstreamnt  +downstreamnt
atgacgtacatcgcacctgaagagagtgcatttggtgttggctttttcgaacgtttggaa
gccaacgccaaacctatgtcgctgacccgtgggccagacgcgtgggatgtactcgaatcg
atcaaacggaatgtctctaacattctgaacactcgaattggtggagcgcaaagtgcccct
catctcgggttggtggattttaatgatgcaacgctggaaaccttagatctctccgtgcga
attaaattggcgattcaacagtgccttgagcgctatgagccgcgtttaactcgcgttctg
gtgagagcggatcaagatagctttaacccgctgactttaaggttccacattaccgcgacc
atcaatagcgaagcgttacacgaaaaagtccagttcagtctgttattggatcaaagcaga
aaatatcgagtgttttaa

DBGET integrated database retrieval system