KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0905
Entry
Vch1786_II0905    CDS       T01650                                 

Definition
(GenBank) type VI secretion system protein ImpH
  KO
K11895  type VI secretion system protein ImpH
Organism
vce  Vibrio cholerae O1 2010EL-1786
Brite
KEGG Orthology (KO) [BR:vce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vce02044]
    Vch1786_II0905
Secretion system [BR:vce02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Vch1786_II0905
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AET29323
Position
2:893882..894898
AA seq 338 aa
MGHTERNAAVDLNSDPAQASPLSLPGNVREYNFYQLVELLQKLADINPESEEWERDCRLV
FSANPSLGFSPSDVMALEARDDERWVMLTNFFGLSGAQSPLPGFILEQLVTEEPGGYKQP
FLDFFNNRLINLVYRVWRKYRYYVRFQPGAQDVFSAQLFALVGLGDPDLRGETPINWCKM
LAYAGTLAGRSRSPQVVAGIIAHCFDLPDVSIRQWVRRRVSIDRSQQLALGKQNARLGMD
TVIGESVIDCSGKFIICIKRLSRSRFADFLPSGKEYQPLCKLVEFILREQMAYDLELAMD
EREAPLFCLDTRQNIALGWTSFLGQDAANKHVLIQVRQ
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggggcacacagagcggaatgcagccgttgatctgaattcagatccagcgcaagcctct
ccgttgagcttgccgggcaatgtacgggaatacaacttctaccaactggttgagctgttg
caaaaactggctgatatcaatcccgaatcggaagagtgggagcgcgattgccgcttggtg
ttcagtgctaacccgagccttggattttcgcccagtgatgtgatggcgcttgaagcgcgt
gacgatgagcgttgggttatgttgaccaacttttttggcctttccggtgcacagtcacct
ctgccggggttcatccttgagcaattggtgacggaagagcctgggggatataagcagccg
tttctcgattttttcaataaccgattgattaatttggtttatcgcgtttggcgtaaatac
cgttactacgtacgttttcagcccggtgcgcaggatgtgttctctgcacagctgtttgcg
ctggtggggttgggcgatcctgaccttcgcggtgaaacgccgatcaactggtgcaaaatg
ctggcttacgcgggcacgctggccggacgtagccgttcgccacaagttgtggccggcatt
attgctcactgttttgatttaccggatgtctccattcgccagtgggtcagacgtcgggta
tcgattgatcggagtcagcaactggcgctgggcaagcagaatgcgcggttggggatggac
acggtgattggcgagtccgttattgattgcagtggaaaatttattatctgtatcaaacgg
ttatctcgcagtcgttttgctgattttttgccctccggtaaagagtatcagccactttgc
aagctggtggagtttattttgcgcgaacagatggcgtatgacctcgagctggcgatggat
gaacgagaagcgccgctgttttgtctggatactagacagaatatcgccctcggctggact
tcgtttcttggccaagatgcagccaataaacatgtgttaattcaagtaaggcaataa

DBGET integrated database retrieval system