KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0912
Entry
Vch1786_II0912    CDS       T01650                                 

Definition
(GenBank) type VI secretion system protein VasI
  KO
K11909  type VI secretion system protein VasI
Organism
vce  Vibrio cholerae O1 2010EL-1786
Brite
KEGG Orthology (KO) [BR:vce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vce02044]
    Vch1786_II0912
Secretion system [BR:vce02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Vch1786_II0912
SSDB
Motif
Pfam: VasI DUF2826
Other DBs
NCBI-ProteinID: AET29330
Position
2:903211..903867
AA seq 218 aa
MRITVLVVSLILGCAGSAHVLAASQDAGSQVEQAELCREIPARLERLACFDRVFATPLEQ
VAIAPSNPYPAEWQRAMAALSESQSEAGWVLGTQGEGRGSSAWIALPAQNRSSGETSPPV
LLLSCINNLSRIELALPKEVADARIQVSIRHETQFWRSDDHGVLFSSARGMPAIEMMKLA
ASESRLLLRSNAPFADGLQFDTRGVNEALDALRERCGW
NT seq 657 nt   +upstreamnt  +downstreamnt
atgagaattaccgttttagtggtcagtttgatcttgggttgcgcgggctctgcgcatgtt
ttagcagcatcgcaagatgcgggctcacaggttgagcaagctgagctgtgccgcgaaatt
cctgcgcgtttagagcgtttggcttgttttgaccgtgtctttgccacgccccttgagcaa
gtggctatcgcaccgtccaatccttatcccgcagagtggcaacgcgccatggcggcattg
tctgagtcgcagtccgaagcgggttgggtattaggtacgcaaggtgaagggcggggcagc
agcgcttggattgctttgcctgcgcaaaatcgcagctcaggggaaacatctccgccagtg
ctcttgctcagttgcattaataacctgagccgcattgagctggctttaccgaaagaagtg
gctgatgcacggattcaagtctctatccgacacgagacacagttctggcgcagtgacgat
cacggcgtactgttttcctcggctcgcggcatgcctgcgatcgaaatgatgaaattggcc
gccagtgagtctcgcctgttgctgcgttctaatgcgccctttgctgacgggttacagttt
gatactcgaggtgtcaatgaagcccttgatgctttgcgcgaacgctgtggttggtaa

DBGET integrated database retrieval system