KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0913Help
Entry
Vch1786_II0913    CDS       T01650                                 

Definition
(GenBank) type VI secretion system protein VasJ
  KO
K11910  type VI secretion system protein VasJ
Organism
vce  Vibrio cholerae O1 2010EL-1786
Brite
KEGG Orthology (KO) [BR:vce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vce02044]
    Vch1786_II0913
Secretion system [BR:vce02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Vch1786_II0913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasJ ImpA_N Dpoe2NT
Motif
Other DBs
NCBI-ProteinID: AET29331
Structure
PDB: 

Position
2:903877..905286
Genome map
AA seq 469 aa AA seqDB search
MEMTEYRQCVAKPISSSNPVGERLVDHPLFDFIEDQMMKVGSLSHASVQWDEVEHSTLKL
LGEQSKDIKLLVYLLQCLHNQVTPTRLITSFAVMSEFLNQYWNDSYPAPGPRGNLPRRKF
FSQMAQRFTTVIEKFDFHHLDEADRQALQAAVEEWQQAVEKQGLSSELVESVVVRITAEI
KRAEQRQQVTAQSSAERETPSAATPSPAASMVVDHSSDKAAKQTLLKVADFLAEQEFGIA
LSIRLRRFAVWGSITSLPDHKPDGETLLRGMQADRVKDYQDQLRHPDLALWRKVEQSLTM
APYWFEGQWMSYTIAQQLGKSDWCQAIAEETQQFLRRLPSLLELKFKGGEPFVSDSVKEW
LASVGQSQGAAGQSVGGDWQEKRKEAFQLAKEGGIAVALSMLNDGLVSAVEPRDKFYWRL
LSADLLRANHLDAMAGEQYQTLLNQVTTLSVPEWEPSLVEQIQRYTTSE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgactgaataccgtcagtgtgtggccaaaccgatcagcagtagcaatcctgtc
ggagagcggctagtcgatcacccactgtttgattttattgaggatcagatgatgaaagtg
ggctctctctctcacgcttcagtgcagtgggatgaagtggagcacagcactctcaaactg
cttggtgaacagagtaaagacatcaagcttttggtttacctgctgcagtgtctgcataac
caagttaccccgacgcgccttattacctcgtttgcggtgatgagtgagttcctcaatcaa
tattggaacgacagttatccagcgccgggcccacgtggcaatctgccgcgacgtaaattt
ttcagccagatggcgcaacgttttaccacggtgatcgaaaagttcgattttcatcatctg
gatgaagcggatcgccaagcgctacaagcggcggttgaagagtggcaacaagccgttgag
aaacaagggctctcttctgagttggtggagtctgtggtggtgcgaattaccgcggagatc
aaacgcgcagagcagcgccagcaagtgacggcgcaaagcagcgcggagcgtgaaacacca
agtgctgcaacgccttctcctgcggcgagtatggtggtggatcattcgagtgacaaagca
gcgaaacaaaccctactcaaagtggcagattttcttgccgaacaagagtttggtatcgct
ctttcgattcgtctgcgccgctttgcggtgtggggcagcattacctcattgcccgatcat
aaacccgatggtgaaacactgctgcgtggaatgcaggcggatcgcgtcaaggattaccaa
gatcaacttcgtcaccccgatttagccttgtggcgcaaagtcgaacagagcttaaccatg
gctccttattggtttgaaggacagtggatgagttacaccattgcccagcaactcggcaaa
agtgattggtgtcaggcgattgccgaagaaacacaacagtttttacgtcgtttgccttcg
ctgcttgagctcaaattcaaaggcggagagccgtttgtcagcgattcggtcaaagagtgg
ctggcgagcgtaggtcagagccaaggtgctgcggggcaatcggtcggcggagattggcaa
gagaagcgtaaagaggcgtttcaactggctaaagaaggtggaatcgcggtggcactttcc
atgctcaatgatggcttggtcagtgcggtggagccgcgagacaaattttactggcgattg
ctatcggcagatctgctgcgggcaaatcatctcgatgcgatggctggtgaacagtatcaa
actctgctcaatcaggtaacgacgctgtctgttcctgagtgggaaccgagtttagtggaa
caaattcaaagatatacaacgtcagagtaa

DBGET integrated database retrieval system