KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0917
Entry
Vch1786_II0917    CDS       T01650                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vce  Vibrio cholerae O1 2010EL-1786
SSDB
Other DBs
NCBI-ProteinID: AET29335
Structure
PDB: 
4NOO 4NSO 4NSR

Position
2:913463..913831
AA seq 122 aa
MNNLLSAYVTMLLILLSISGGAIASENCNDTSGVHQKILVCIQNEIAKSETQIRNNISSK
SIDYGFPDDFYSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVD
NS
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaataacttgctttctgcgtatgtaactatgctgttgatattattaagtattagtggt
ggcgctattgctagtgaaaactgcaatgatacatctggagtgcatcaaaaaattctagtg
tgtatccaaaatgagatagctaagtcagagactcagattagaaataatatttcttctaag
tctatagattatggctttcctgatgatttctacagcaagcaaagattagctattcatgaa
aagtgtatgctttatataaatgtcggtggccaacgtggtgaattgctaatgaaccaatgt
gaactttcgatgctacaaggccttgatatttacattcaacagtatatagaggatgttgat
aatagttag

DBGET integrated database retrieval system