KEGG   Vibrio cholerae O1 El Tor FJ147: IR04_02345Help
Entry
IR04_02345        CDS       T03827                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
vcf  Vibrio cholerae O1 El Tor FJ147
Pathway
vcf00430  Taurine and hypotaurine metabolism
vcf00460  Cyanoamino acid metabolism
vcf00480  Glutathione metabolism
vcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    IR04_02345
   00460 Cyanoamino acid metabolism
    IR04_02345
   00480 Glutathione metabolism
    IR04_02345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vcf01002]
    IR04_02345
Enzymes [BR:vcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     IR04_02345
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     IR04_02345
Peptidases and inhibitors [BR:vcf01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   IR04_02345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AJZ98072
UniProt: A0A4S3QME5
Position
II:469185..470753
Genome map
AA seq 522 aa AA seqDB search
MARIAFTAPHHKASETGLDILRQSGTACEAMVAAAAMIAVQYPHMNSIGGDGFWLIAAKD
KPPVAIDACGSSAQSIALTDYDPAQGLPQQGGAAALTMAGTISGWQTALQLFSSGISLST
LLSPAIQAAEQGILTTPSLAAASHKTWNRLAKLEPFAQIYLNPFRDTLKVGDIVTQKALA
KTLTHLSQFGLDAFYQGELAQQMAKELEEAGSPLRLADFIQHKASIVTPLTHNMSQGQFY
NLGAPTQGLASLLILGIYDRLAHQARSQADHVHLLIEATKIAFDIRNRAVTDEKYIPTAL
QNYLIAERVDKLAEKVNLSQAAAWPQKTQLGDTVWMGAVDRYGTMVSFIQSIYWEFGSGV
VLPSSGVLWNIRSQSFSLDPEHINCLASRKKPFHTLNPAYAELKDGRRMVYGTMGGDGQP
QTQACLISRYLYQGDSLEQSIAKPRWLLGRTWGDSTTKLQMESSLMGQLGTELSARGHQI
NSVPDGIELMGHAGAIVVGTDSSLEVASDPRSDGAALQLWLE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgaattgcgtttacggctccccatcacaaagccagtgaaaccggtttagatatc
cttcgccaaagtggaacggcttgtgaggctatggtcgcagcagcggcgatgatcgcagta
caatatccccacatgaatagtattggtggggatggtttttggcttattgccgctaaagac
aaaccgcctgttgctattgatgcgtgcggatcttcggcgcagagtattgctctgacggat
tatgaccctgcccaaggattaccacagcaaggtggtgccgcagcactgacgatggcggga
accatttcgggttggcaaacggcgttgcagctcttttcatcagggatttctctctcaacc
ctgcttagtcctgcaattcaagcggcagagcagggaattcttaccactccgagtcttgcc
gcggcaagtcataaaacgtggaaccgattagctaagttagaaccttttgcacaaatctat
ttgaatccttttcgagatacgctcaaagtcggtgacattgtcacgcaaaaggcgctggcg
aagacattgacccatttatcccagtttgggcttgacgctttttaccaaggcgagttagct
caacaaatggctaaagagttggaagaggcaggaagccccctacgtttagcagactttatc
cagcataaagccagtatcgttactccgctcactcataatatgtcccaaggccagttctat
aatctgggggctccgactcaagggttagcctcgttattgattctgggaatttatgatcga
ctggcgcatcaggcgagatcgcaagccgatcatgtccatctgctcattgaagcaaccaaa
attgcgtttgatattcgtaatcgagcggttactgatgaaaaatacattccgaccgcgctg
caaaattacctcattgccgaacgagtcgataaacttgcagagaaggtaaatctctctcaa
gctgcagcttggccgcaaaaaacgcaacttggtgatactgtctggatgggcgcagtagac
cgatatggcactatggtaagttttattcagagtatttactgggagtttggtagcggtgtt
gttctaccttctagtggagtgctctggaacatacgtagccaaagtttttctttggatccc
gaacacatcaattgtctggcctcacgtaaaaagccatttcataccttgaatcctgcctat
gccgagcttaaagatggccgaagaatggtttacggaaccatgggcggagatggccaacca
caaactcaagcctgtttgatcagtcgttacctatatcaaggcgattcactggagcaatcg
atcgcaaaaccccgttggttattggggagaacgtggggagatagcacgacaaaactgcag
atggagtcgtctttgatggggcaactcggcactgagttgtctgcccgcggtcatcaaatc
aattcggttcccgatggtattgaattgatggggcatgcaggagcgattgttgttggtacg
gattccagccttgaagtcgcaagcgatcctcgcagtgatggcgctgcattacaactgtgg
ctggaataa

DBGET integrated database retrieval system