KEGG   Vibrio cholerae O1 El Tor FJ147: IR04_03325Help
Entry
IR04_03325        CDS       T03827                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vcf  Vibrio cholerae O1 El Tor FJ147
Pathway
vcf00260  Glycine, serine and threonine metabolism
vcf01100  Metabolic pathways
vcf01110  Biosynthesis of secondary metabolites
vcf01120  Microbial metabolism in diverse environments
vcf01130  Biosynthesis of antibiotics
vcf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    IR04_03325
Enzymes [BR:vcf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     IR04_03325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AJZ98253
Position
II:683202..684209
Genome map
AA seq 335 aa AA seqDB search
MDFRSDTVTQPTDAMRQAMAQAPVGDDVYGDDPTVNELEQWAAERHGFEAALFTTSGTQA
NLLGLLAHCERGDEYLCGQQAHNYRYEAGGAAVLGSIQPQPIDNEPDGTLDFAKLKAAIK
PDDAHFARTKLLSLENTINGKVLPLSYLAKAREFVDQHGLQLHLDGARVYNAAVALDVDV
KEIAQYFDSITVCLSKGLAAPVGSLLLGSKDFIAKARRWRKMVGGGMRQAGILAAAGKLA
LTEQVMQLKTDHDNARHLALGLNALPGFSVNTEWVQTNIVFAKLDSTVDIQSIAQQLRQA
GIIITAGNPVRFVTHKDITRQDIDTLLAKLRTLLA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggactttcgatcggataccgttacccaaccgaccgacgcgatgcgtcaagcgatggca
caagcccctgtgggtgacgatgtgtatggcgatgaccccaccgtcaacgagttagaacag
tgggcggcagagcgccatggctttgaagccgcgctgtttaccacctcaggcactcaagcc
aatttgttaggtttactcgcccattgcgaacgcggcgacgaatatttgtgtggccagcaa
gcccataactatcgttatgaagctggcggtgctgccgtacttggctctatccagccacaa
ccgattgacaatgaaccggatggcacactcgatttcgccaaactcaaagccgcgatcaaa
ccggatgatgcacattttgcccgcaccaaactgctcagcttggaaaacaccatcaatggt
aaagtgcttccactcagttatttggcgaaggcgcgcgagtttgttgatcaacatggtttg
caactgcaccttgatggggctcgggtctacaacgcggcggtcgcactggatgtggatgtc
aaagagatcgcgcaatattttgattcgatcaccgtgtgtctatccaaaggcttagccgcg
ccagtcggttcgttactgctcggttccaaggactttattgccaaagcgagacgctggcga
aaaatggtcggtggcggtatgcgccaagcgggcattttagccgcagcggggaaattggcg
ctcaccgagcaagtcatgcagctcaagaccgatcatgataatgctcgtcatctggctttg
gggctgaatgctttaccggggttttcggttaataccgaatgggtacagaccaatattgtg
tttgctaaattggactcgacagtcgatatccagtccatcgcccagcaacttcgccaagca
ggcattatcatcaccgcgggtaatccagtgcgcttcgtgacacataaagacattacacgt
caggatattgataccctactcgccaaactgcgcaccttactggcttga

DBGET integrated database retrieval system