KEGG   Vibrio cholerae O1 El Tor FJ147: IR04_09355Help
Entry
IR04_09355        CDS       T03827                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
vcf  Vibrio cholerae O1 El Tor FJ147
Pathway
vcf00620  Pyruvate metabolism
vcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IR04_09355
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vcf02000]
    IR04_09355
Enzymes [BR:vcf01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     IR04_09355
Transporters [BR:vcf02000]
 Other transporters
  Primary active transporters [TC:3]
   IR04_09355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AJZ99345
UniProt: A0A4S3QX79
Structure
PDB: 

Position
I:complement(932809..934608)
Genome map
AA seq 599 aa AA seqDB search
MTQAIKRVGVTDVVLRDAHQSLFATRLRIDDMLPIAQQLDQIGYWSLECWGGATFDSCIR
FLGEDPWQRLRLLKQAMPNTPLQMLLRGQNLLGYRHYADDVVDTFVERAVKNGMDVFRVF
DAMNDVRNMQQALQAVKKMGAHAQGTLCYTTSPVHNLQTWVDVAQQLAELGVDSIALKDM
AGILTPYAAEELVSTLKKQVDVELHLHCHSTAGLADMTLLKAIEAGVDRVDTAISSMSGT
YGHPATESLVATLQGTGYDTGLDIAKLEQIAAYFRDVRKKYHAFEGMMKGSDARILVAQV
PGGMLTNMESQLKQQNALDKLDLVLEEIPHVREELGFLPLVTPTSQIVGTQAVINVVLGE
RYKTITKETSGVLKGEYGKTPAPVNTELQARVLAGAEAITCRPADLIAAEMPTLQDRVLQ
QAKEQYITLAENAIDDVLTIALFDQVGWKFLANRHNPEAFEPAPQAISSACAPKAPTEKS
KVQPVESHGVYTITVNNQSYVVKVDEGGDLTHVAPTASTNHAPVPSAAEGENLAAPLSGN
IWKIHASAGDEVAEGDVLLILEAMKMETEIRAPRAGVISAIEVNEGDAVQVGDALLVLA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggcgatcaaacgcgttggtgttacggatgtcgtattgcgcgatgcgcaccaa
tctctttttgccacccgtttacgaattgacgacatgctgccgattgcgcagcaattagat
cagatcggctattggtctttggaatgttggggaggcgcgacctttgacagctgcatccgc
tttttaggcgaagacccatggcaacgcctacgtttactcaaacaagccatgcccaatacg
ccactgcaaatgctgctgcgcgggcaaaacctgcttggctaccgccactatgccgatgat
gtagtggatacttttgtggagcgtgcggtgaaaaacggcatggatgtatttcgtgtcttc
gatgcgatgaacgatgtacgcaacatgcaacaggcgctgcaagcggtgaaaaagatgggc
gcgcatgcgcaaggcacgctctgctacaccactagcccagtacacaatttacaaacttgg
gtcgatgtggcgcagcaactggctgagcttggtgtcgactcaattgccctgaaagatatg
gccggcattttgaccccgtatgccgctgaagagctggtgtctaccctgaaaaaacaagtg
gatgtcgagctgcatctgcactgccactccaccgctggccttgccgatatgactctgctt
aaagcaattgaagcaggcgtggatcgagtggataccgcgatttccagcatgagtggcact
tatggtcatccggcgaccgaatcactggttgcaaccttacaaggcacgggctacgacacc
ggattggatattgccaaactcgaacagattgcggcttacttccgtgatgtacgcaaaaaa
taccacgcctttgaaggcatgatgaaaggcagtgatgcgcgcattttggtggctcaggtt
ccgggcggcatgctaaccaacatggaaagccagctcaaacaacaaaacgcgctggataaa
ctcgatttagtgcttgaagagatcccacacgtacgtgaagaactcggctttttgcctctg
gtcacccctacctcacaaattgtcggtacacaagcggtaatcaacgtggtgctgggtgag
cgttacaaaaccatcaccaaggaaaccagcggtgtgctgaaaggagaatacggcaaaacg
ccagcaccggttaacactgagctgcaagctcgcgtgttggcgggcgcagaagccattact
tgtcgccctgcggatttgattgccgccgaaatgccaaccttgcaagaccgcgtattgcag
caagctaaagagcagtacatcaccctcgccgagaatgcgattgatgatgtactgaccatt
gcgctgtttgatcaggtaggctggaagtttttagccaaccgccataacccagaagccttt
gaacctgcgccgcaagcgataagttcagcctgcgcaccgaaagcgccaacagaaaaaagc
aaagtacagccagtggaaagtcacggtgtgtacaccattacggtgaacaaccaaagttat
gtggtgaaggtggatgaaggcggtgacctgacgcatgttgcgccgacggcatcaaccaac
cacgcaccagtcccgagtgccgcagaaggtgaaaacctcgccgcgccgctctctggcaac
atttggaaaattcatgcctcagccggtgatgaagtggccgaaggtgatgtcttgctgatt
ttagaagccatgaagatggaaaccgaaattcgcgcgccacgtgccggagtgatcagtgcc
attgaagtcaatgaaggcgatgccgtacaagtcggtgatgctttgttggtattggcgtaa

DBGET integrated database retrieval system