KEGG   Vibrio cholerae O1 El Tor FJ147: IR04_18735Help
Entry
IR04_18735        CDS       T03827                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
vcf  Vibrio cholerae O1 El Tor FJ147
Pathway
vcf00010  Glycolysis / Gluconeogenesis
vcf00020  Citrate cycle (TCA cycle)
vcf00620  Pyruvate metabolism
vcf01100  Metabolic pathways
vcf01110  Biosynthesis of secondary metabolites
vcf01120  Microbial metabolism in diverse environments
vcf01130  Biosynthesis of antibiotics
vcf01200  Carbon metabolism
Module
vcf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IR04_18735
   00020 Citrate cycle (TCA cycle)
    IR04_18735
   00620 Pyruvate metabolism
    IR04_18735
Enzymes [BR:vcf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     IR04_18735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_25
Motif
Other DBs
NCBI-ProteinID: AKA01117
Position
I:2994633..2996261
Genome map
AA seq 542 aa AA seqDB search
MTVMEHTKAAQIDLAQYGITGVTELVRNPSYEMLFAEETRSDLEGYERGVVTELGAVAVD
TGIFTGRSPKDKFIVKDDTTRDTLWWTSDKAKNDNKPINQEVWNDLKALVTKQLSGKRVF
VLDGYCGANADTRLSVRFITEVAWQAHFVKNMFIRPSEEELAHFKPDFVVMNGAKCTNAK
WKEHGLNSENFTVFNLTERMQLIGGTWYGGEMKKGMFAMMNYFLPLQGIASMHCSANMGK
AGDVAIFFGLSGTGKTTLSTDPKRALIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPD
IYNAIRRDALLENVTVRSDGSIDFDDGSKTENTRVSYPIYHIDNIVKPVSKGGHATKVIF
LSADAFGVLPPVSKLTPEQTKYHFLSGFTAKLAGTERGITEPTPTFSACFGAAFLTLHPT
QYAEVLVKRMEAAGAEAYLVNTGWNGSGKRISIKDTRGIIDAILDGSIEKAETKHIPIFN
LQVPTALPGVDPMILDPRDTYVDPLQWESKAKDLATRFINNFDKYTDNAEGKALVAAGPK
LD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttatggaacatactaaggctgcacaaatcgacctagcccaatatgggatcacc
ggcgtaactgaactggttcgtaacccgagctatgaaatgttatttgccgaagaaacccgt
tcagatctcgaaggttatgaacgtggtgtggtgactgaattgggtgctgttgcggttgat
actggcatcttcactggccgctcaccaaaagataagtttatcgttaaagatgataccact
cgcgatacgctgtggtggacgtcagacaaagcgaaaaacgacaacaaaccgatcaatcaa
gaagtgtggaatgacctgaaagccttggtgaccaagcagctttctggtaaacgcgtattt
gtgctcgatggctactgtggtgccaacgccgatactcgcttaagtgttcgcttcatcacc
gaagtagcatggcaagcacactttgtgaaaaacatgttcattcgtccaagcgaagaagag
ctggcacactttaaaccagactttgtcgtaatgaacggcgcaaaatgtaccaatgcgaag
tggaaagagcacggtctgaactcagaaaacttcactgtgtttaacctgaccgagcgcatg
cagctcatcggcggtacttggtacggcggtgagatgaaaaaaggtatgttcgcgatgatg
aactacttcctgccgctacaaggcattgcctctatgcactgctctgccaacatgggtaaa
gcgggcgatgtcgccatcttcttcggtctttctggtacgggtaaaaccaccctatccacc
gatccaaaacgtgcgttaattggtgacgatgagcacggctgggatgatgatggcgtgttc
aactttgaaggcggctgctacgcgaaaaccatcaagctgtctaaagaagcagagccggat
atctataacgcgatccgccgtgatgctctactggaaaacgtcacggttcgtagtgatggt
tcgattgattttgatgatggttcaaaaaccgagaacacccgtgtttcttaccctatttat
cacatcgacaacatcgtaaaaccagtttccaaaggcggtcatgcgactaaggtgatcttc
ctgtctgccgatgcgtttggcgtattgcctccagtttcaaaactgacgccagagcaaacc
aagtaccacttcttgtctggctttacggctaaactggcaggtactgagcgtggcattact
gaacctaccccaaccttctccgcctgttttggcgcagcgttcctcactctgcacccaact
cagtatgcagaagtgctggtaaaacgtatggaagcagcgggcgccgaagcctatctggtt
aacacaggttggaacggcagcggtaagcgcatctcaattaaagatacgcgcggtattatc
gatgcgattttggatggttcgatcgaaaaagcggaaaccaaacatatcccaatctttaat
ctgcaagtgcccaccgcactgcccggcgtcgatcctatgatcctcgacccacgtgatact
tatgttgacccactgcagtgggaaagcaaagccaaagacttggcaacgcgcttcatcaac
aacttcgacaagtacacagataacgccgaaggtaaagcactggttgccgcgggcccaaag
ctcgactaa

DBGET integrated database retrieval system