KEGG   Vibrio cholerae O1 El Tor N16961: VC0267Help
Entry
VC0267            CDS       T00034                                 

Definition
(RefSeq) D-isomer specific 2-hydroxyacid dehydrogenase family protein
Organism
vch  Vibrio cholerae O1 El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 2-Hacid_dh IlvN Shikimate_DH AdoHcyase_NAD Pyr_redox_2 XdhC_C
Motif
Other DBs
NCBI-GeneID: 2614473
NCBI-ProteinID: NP_229923
UniProt: Q9KV89
Position
I:complement(272562..273485)
Genome map
AA seq 307 aa AA seqDB search
MNNFHQLYILTEHDEHYREQILERQLEGLALTEDRAKATILLAAPPMAARRLDEFPRLQW
LHSAYAGVDTLMDPKLRKNYLLTNVKGIFGHLIAEYVMGYAIQYQRDFRLYQTQQAERLW
QPRPYSSLANQTLVILGTGSIGSHLAHVAKQFGLRVVGVNRTGIPAKEGHFDATYHISEL
PAALMRADLLVNTLPNTPATEGLLNQENLRHCHQALLFNVGRGKTLVEQGLPDLIAAGHI
RHAFLDVFIKEPLAQDHPFWDNPAITITPHIAAVSFPEQVVDIFADNYQRWCDNLPLRNQ
IDFEKGY
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatttccaccagctgtatattctgactgaacatgatgaacactaccgcgagcag
atccttgagcgccaactggaagggctcgccttgaccgaagatcgcgccaaggccacgatt
ttgttggccgcaccgccgatggccgcccgccgtttggatgagtttccgcgcttgcaatgg
ctgcattccgcctatgccggcgtcgataccttgatggaccccaaactgcgcaaaaactat
ctgctgaccaacgtcaaaggcatcttcgggcacctgatcgccgagtatgtgatgggttac
gctatccaatatcagcgcgattttcgcctgtatcaaacccaacaagctgagcgcctttgg
cagccgcgcccttactcttcacttgccaatcaaaccctagtgattttgggcactggctcg
attggtagccatttagcccatgtggctaaacagtttgggctgcgagtggtgggcgtcaat
cgcaccggcattccggccaaagaagggcattttgatgccacttatcacatcagtgagctg
ccagccgctttaatgcgcgccgacttactggtgaatacgctgcccaacacccccgcaacc
gaagggctgctcaatcaagaaaatcttcgccactgccaccaagcgctgctgtttaacgtc
gggcgtggcaaaacgttagtagagcagggtctgccggatttaattgcagcaggacacatt
cgccacgcgtttttggatgtgtttatcaaagagccactcgctcaagatcacccattctgg
gacaatccggcgatcaccatcacaccacacatcgcggcggtcagctttccagagcaagtg
gtcgatatcttcgccgataactaccaacgttggtgcgataacttgccactgcgtaatcag
attgattttgaaaaaggctactga

DBGET integrated database retrieval system