KEGG   Vibrio cholerae O1 El Tor N16961: VC0744
Entry
VC0744            CDS       T00034                                 

Gene name
secF
Definition
(RefSeq) preprotein translocase subunit SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch03060  Protein export
vch03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vch00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    VC0744 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VC0744 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vch02044]
    VC0744 (secF)
Secretion system [BR:vch02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   VC0744 (secF)
SSDB
Motif
Pfam: SecD_SecF Sec_GG Peptidase_M19 DUF1673
Other DBs
NCBI-GeneID: 2615753
NCBI-ProteinID: NP_230393
UniProt: Q9KTY6
Position
I:797707..798654
AA seq 315 aa
MFQILKADKMIDFMRWSKFAFALSLVMIAASIFTLSTKWLNWGLDFTGGTLIEVGFEQPA
NLEQIRSALEAKGFGDATVQNFGSARDVMVRLRPRDDMAGEALGNQILAAIKEGTGGNVE
MRRIEFVGPNVGDELTEAGGLAILVSLLCILLYVSVRFEWRLAAGAVLALAHDVIITLGI
FSILQIEVDLTIVAALLTVVGYSLNDTIVVFDRIRENFRKMRKEEPAEIMNSSITQTLSR
TLITSGTTLFVVIALFTQGGAMIHGFALALLLGITVGTYSSIYVASALALKLGITREHLL
PPQVEKEGAELDEMP
NT seq 948 nt   +upstreamnt  +downstreamnt
atgtttcaaatcctaaaagcagacaaaatgatcgactttatgcgttggtcgaaattcgcc
ttcgccttgtcgctggtgatgattgccgcatcgatttttactctgtctaccaagtggctc
aactgggggctggatttcacgggcggtactttgattgaagtgggctttgaacagcctgcc
aatctggagcaaatccgtagcgcccttgaagcgaaaggttttggtgatgctaccgtgcaa
aactttggttctgcacgtgatgtgatggtacgtctacgtcctcgtgatgatatggcgggt
gaggcgttgggtaaccagatcctcgcggcgatcaaagaaggtaccggcggcaacgtggaa
atgcgccgtatcgaattcgttggcccgaacgtgggtgatgagctcactgaagcgggcggc
ttggcgattctggtttctttgctgtgtatcttgctttacgtgtcagtacgctttgaatgg
cgtttggctgcaggtgcggtgctggcattggcgcacgacgtcatcattaccttaggcatc
ttctctatcttacagattgaagttgatctcacgattgttgcagcattgctgacggttgtg
ggttactcacttaacgataccattgtggtgtttgaccggatccgtgaaaacttccgtaag
atgcgcaaagaagaacccgcagagatcatgaatagctcaattacacaaactttgagccgt
actttgatcacttcaggtaccactttgtttgtggtgattgccctctttactcaaggtgga
gcaatgatccacggttttgcgctggccttgttgctgggtattaccgttggtacttattct
tctatttatgtggcatcagcactggcgctgaaactcgggatcacccgtgagcacttattg
cctccacaagtagagaaagaaggcgcagagttggatgaaatgccgtag

DBGET integrated database retrieval system