KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1169Help
Entry
VC1169            CDS       T00034                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00260  Glycine, serine and threonine metabolism
vch00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vch01100  Metabolic pathways
vch01110  Biosynthesis of secondary metabolites
vch01130  Biosynthesis of antibiotics
vch01230  Biosynthesis of amino acids
Module
vch_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VC1169 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VC1169 (trpA)
Enzymes [BR:vch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VC1169 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-GeneID: 2614602
NCBI-ProteinID: NP_230814
UniProt: Q9KST7
Structure
PDB: 

Position
I:complement(1242248..1243054)
Genome map
AA seq 268 aa AA seqDB search
MNRYQALFQRLSAAQQGAFVPFVTIGDPNPEQSLAIMQTLIDAGADALELGMPFSDPLAD
GPTIQGANLRALAAKTTPDICFELIAQIRARNPETPIGLLMYANLVYARGIDDFYQRCQK
AGVDSVLIADVPTNESQPFVAAAEKFGIQPIFIAPPTASDETLRAVAQLGKGYTYLLSRA
GVTGAETKANMPVHALLERLQQFDAPPALLGFGISEPAQVKQAIEAGAAGAISGSAVVKI
IETHLDNPAKQLTELANFTQAMKKATKI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttatcaagccctatttcaacgcctgagcgccgctcagcaaggcgctttcgtt
cctttcgtgaccattggtgacccaaaccccgagcagtcactcgccatcatgcaaaccctg
attgatgcaggagcggatgcgcttgagcttggcatgccgttttcagatcctctggccgat
ggtccgacgattcaaggcgcgaacttacgtgcattagcggcgaaaaccacgccagatatc
tgttttgagctgatcgcgcagatccgtgcgcgtaaccctgagactccgattggcttactg
atgtatgccaacttggtttacgcacgcggcatcgacgatttttatcaacgctgccaaaaa
gctggcgtggattcggtactgattgccgatgtacccaccaacgaaagccagccttttgtg
gcggccgcagagaaatttggcattcaaccaatctttattgcgccaccaacggccagtgat
gaaaccttacgagcagttgctcaactcggtaaaggctacacttatttgctttcgcgcgct
ggggtgactggggctgaaaccaaagccaacatgcctgtgcatgccctgcttgaacgtctg
caacaatttgatgcgccaccagcactgctaggttttggtatttcagagcccgctcaagtt
aaacaagcgattgaagctggcgcagcgggagccatttccggatcggcggtggtaaaaatc
atcgaaacgcatttggataatccagctaagcagctgactgagctggcaaacttcactcaa
gccatgaaaaaagcaacaaaaatttaa

DBGET integrated database retrieval system