KEGG   Vibrio cholerae O1 El Tor N16961: VC1415
Entry
VC1415            CDS       T00034                                 

Definition
(RefSeq) hcp protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VC1415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vch02044]
    VC1415
Secretion system [BR:vch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VC1415
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-GeneID: 2614047
NCBI-ProteinID: NP_231058
UniProt: H9L4Q3
Structure
PDB: 
5MXN

Position
I:1509632..1510150
AA seq 172 aa
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPS
GQRVHKPFKFTVALNKAVPLLYNALSSGEKLKTVELKWYRTSIEGKQENFFTTKLENASI
VDIHCEMPHCQDPAKSDFTQNVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccatgttatatctctatcgaaggccaaactcagggtcttatcactgcaggt
gcatgtactgctgactctatcggcgattcattcgttgaaggccacgaagatgagatgctg
gttcagcagtttgaccacgttgtgactgtaccgactgacccacaatctggtcagccttca
ggccaacgtgtgcacaagccattcaaattcactgtggcgctgaacaaagcggttcctctg
ctgtacaacgcgctctcttctggtgagaagctgaaaaccgttgagctgaagtggtaccgt
acctctatcgaaggtaaacaagagaacttcttcaccactaagctggaaaacgcgtctatc
gtcgacatccactgtgaaatgccacactgccaagacccagcaaaatctgactttactcag
aatgtgactgtgtctctgtcttaccgcaaaatcacttgggaccacgttaacgcgggcacc
tcaggctctgatgactggcgtaagccaatcgaagcgtaa

DBGET integrated database retrieval system